 |
 |
 |
|
|
 |
|
|
 |
 |
|
|
|
 |
|
Contact Us
|
Copyright © 1995-2006
DDBJ All rights reserved. |
|
DNA Data Bank of Japan
DNA Database
Release 57, March 2004, including 32,693,678 entries, 38,008,449,840 bases
This database may be copied and redistributed without permission on the
condition that all the statements in this release note are reproduced in each
copy.
The present release contains the newest data prepared by the DNA Data Bank of
Japan (DDBJ), GenBank, and European Molecular Biology Laboratory/European
Bioinformatics Institute (EMBL/EBI) as of February 25, 2004. This unified database
was made possible thanks to the international collaboration among the three
data banks. All the entries have accordingly been annotated using the feature
keys common to them.
All the entries designated by the accession numbers with the prefixes "C",
"D", "E", "AB", "AG", "AK", "AP", "AT", "AU", "AV", "BA", "BB", "BD", "BJ",
"BP", "BS", "BW" and "BY" have been collected and processed by DDBJ, and the rest
have been prepared by GenBank and EMBL/EBI.
There have been a number of genome projects going on worldwide. Among them
human genome projects have probably been most productive and yielded a large
number of ordinary sequences, huge amounts of ESTs and quantities of genome
sequences. Thus, we have the human(HUM) division solely for human sequences
and the primate (PRI) division for non-human primate sequences. The HUM
division in this release was recorded in 21 files each of which had 300 MB
storage capacity. Incidentally, the BCT, HTC, INV, PLN, ROD, STS, VRL and
VRT divisions were recorded in 7, 3, 6, 9, 10, 3, 3, 4 files, respectively.
Note that the EST division also contains human sequences.
The present release does not have the ORG division. Thus, if you are interested
in human mitochondrial sequences, for example, you are now advised to refer to
the HUM division.
This release includes a division (PAT) for patent data. The patent data
are those which the Japanese Patent Office (JPO), United States Patent and
Trademark Office (USPTO), and the European Patent Office (EPO) collected and
processed. The accession numbers of the patent data collected by the Japanese
Patent Office start with the prefix "E" and "BD", those collected and supplied
by USPTO and GenBank respectively start with "I" and "AR", and those collected
and supplied by EPO and EMBL/EBI respectively start with "A" and "AX". The
entries with the prefixes "I", "AR", "A", "AX", "E" and "BD" were allocated
to ten files (ddbjpat1.seq _ ddbjpat10.seq) in the DDBJ format. Note also
that unauthorized use of the patent data may cause legal issues for which
we take no responsibility.
In the present release, the SOURCE in the flat file was revisited and revised
if necessary in accordance with the unified taxonomy database common to the
three data banks.
The number of ESTs has been increasing at an enormous rate and is expected
to be growing even more rapidly in the future. Therefore, EST data were
stored in 223 files each of which had the same storage capacity as the file
of the HUM division.
The present release includes the GSS division. GSS stands for the Genome
Survey Sequence, which is similar to EST, except that GSS is genomic DNA
whereas EST is cDNA. This division was recorded in 80 files similarly to
the HUM division.
This release also includes the High Throughput Genomic Sequence (HTGS), which
comes mainly from genome project teams which deal with a clone as a sequencing
unit. HTGS in this release were recorded in 52 files similarly to the HUM
division.
The index files are not presented in this release except for ddbjacc.idx,
ddbjgen.idx, ddbjjou.idx, and ddbjkey.idx. Instead, we have included a program
by which to make the index files not presented in this release. For the use of
the program, see the files, seq2indexes.doc, seq2indexes.c, and seq2indexes.h
in this release.
The present release contains amino acid sequences that were translated from
the corresponding nucleotide sequences in our database. In the translation
we paid much attention to the fact that some species or organella have a
codon different from the universal one, and used the proper codon table. If
you find an incorrect codon in a translated sequence, please let us know.
The three data banks include the item VERSION in the flat file, which
indicates a version of a submitted nucleotide sequence (see Table 1). It is
expressed like AB123456.1, in which the digit(s) after the period is a
version number. The reason for adding VERSION is that since a released
sequence sometimes revised by the submitter, the accession number alone cannot
specify the sequence in question causing the user a trouble. The number is
increased by one every time when a revised sequence is made public.
Accordingly, the translated protein sequence will be accompanied with a
/protein_id which is expressed as BAA12345.1, in which the digit(s) after the
period is again a version number. The number is increased by one when the
corresponding nucleotide sequence is revised and the protein sequence is
changed as a result, and when the revised protein sequence is made public.
We terminated the RNA division. The RNA data have been redistributed according
to the category of the organism. Therefore, you will find a human RNA
sequence, for example, in the HUM division.
The present release includes a division, CON. The CON division is to show the
order of related sequences in a genome, and expressed by join and the accession
numbers of the sequences. The contents of the CON division are compiled by the
three data banks not by the data submitter. The current number of the entries
of this division is 16190. The entries and bases in the CON division are not
counted in the released numbers on the top of the release note.
The present release also includes, HTC (High Throughput cDNA). This division
is to include unfinished high throughput cDNA sequences, each of which has
5'UTR and 3'UTR at both ends and part of a coding region. The sequence may
also include introns. When the sequence becomes finished later, it moves
to the corresponding taxonomic division. The sequence is accompanied with
a keyword, HTC (High Throughput cDNA), which is dropped when the sequence
is finished and moved to a taxonomic division.
Since release 51, TPA (Third Party Annotation) data have been available. The
entries and bases in TPA are not counted in the released numbers on the top of
the release note.
Since release 54, '/sequenced_mol' qualifier has been changed to '/mol_type'
qualifier. We accordingly completed retrofitting the pertinent entries.
This change was made on the agreement at the INSD international collaborative
meeting in 2002.
/mol_type qualifier
Definition: in vivo molecule type
Value format: molecule type
where molecule type is limited to followings;
"genomic DNA", "genomic RNA", "mRNA" (incl. EST), "tRNA", "rRNA",
"snoRNA", "snRNA", "scRNA", "pre-mRNA", "other RNA" (incl. synthetic),
"other DNA" (incl. synthetic), "unassigned DNA" (incl. unknown),
"unassigned RNA" (incl. unknown)
The BASE COUNT line of the DDBJ flat file format has been changed since DDBJ
release 56, corresponding to the relaxation of the maximum sequence length
restriction (350,000 bp/entry) in the entry that had been practised at
DDBJ/EMBL/GenBank International Nucleotide Sequence Databases. In the BASE
COUNT line of the DDBJ flat file format, 6 digits had been allocated for each
number of a, c, g, t and other bases in the sequence. Hereafter, in the new
flat file format, 9 digits are allocated for each number of a, c, g and t,
while the numbers of other bases are removed. In accordance with the
relaxation of sequence length limitation, GenBank had already dropped the BASE
COUNT line from their flat file format from GenBank Release 138 (Oct. 2003).
We DDBJ have decided to maintain the BASE COUNT line in our flat file format
from the view that GC contents are still important information to characterize
the sequence.
Prior to publication of release 56 in December, 2003, the new DDBJ flat file
format is adopted to daily data update from Dec. 3.
Following is an example of the new BASE COUNT line.
1 6 11 16 21 26 31 36 41 46 51 56 61 66 71
|----|----|----|----|----|----|----|----|----|----|----|----|----|----|
BASE COUNT 123456789 a 123456789 c 123456789 g 123456789 t
This release is published by the following DDBJ staff.
T. Gojobori, Y. Tateno, K. Nishikawa, H. Sugawara, N. Saitou, K. Okubo,
S. Miyazaki,K. Ikeo, Y. Suzuki, S. Fukuchi, A. Kinjo, K. Itoh,
S. Adachi, H. Aono, M. Ejima, N. Endo, Y. Fujisawa, D. Fukuda, M. Gojobori,
A. Hashizume, T. Hirai, N. Hoshi, H. Ichikawa, K. Ichikawa, T. Iizuka,
N. Ishizaka, T. Kato, T. Kawamoto, J. Kohira, Ta. Koike, To. Koike, T. Konno,
T. Kosuge, A. Kusakabe, Y. Lin, K. Mamiya, N. Maruyama, J. Mashima, M. Matsuo,
K. Mimura, S. Misu, S. Miyazawa, N. Murakata, S. Nagira, M. Nagura,
N. Nishinomiya, T. Okido, K. Sakai, Y. Shigemoto, F. Sugiyama, M. Suzuki,
T. Takaki, H. Tsutsui, M. Tsuboi, K. Watanabe, M. Yamaguchi, Y. Yamamoto,
E. Yokoyama
Center for Information Biology and DNA Data Bank of Japan
National Institute of Genetics
Mishima 411-8540, Japan
Phone: +81 55 981 6853
FAX: +81 55 981 6849
E-mail: ddbj@ddbj.nig.ac.jp (for general inquiry)
ddbjsub@ddbj.nig.ac.jp (for data submission)
ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication)
WWW: http://www.ddbj.nig.ac.jp/ (for DDBJ WWW server)
http://sakura.ddbj.nig.ac.jp/
(for DDBJ sequence data submission system)
Acknowledgement: We are grateful to NCBI and EMBL/EBI for a firm friendship
and an excellent collaboration with us. We also thank the Japanese Patent
Office for a steady cooperation with us. The operation of DDBJ is supported
by the Ministry of Education, Culture, Sports, Science and Technology, and we
would gratefully note this here.
DDBJ Database Release History
Release Date Entries Bases Comments
57 03/04 32,693,678 38,008,449,840
56 12/03 30,405,173 36,079,046,032
55 09/03 27,753,140 34,280,225,489
54 06/03 25,149,821 32,162,041,177
53 02/03 23,250,813 29,711,299,332
52 12/02 20,354,812 26,931,456,316
51 09/02 18,401,358 22,782,404,136 TPA started
50 06/02 17,260,693 20,158,357,982
49 04/02 16,503,157 18,579,627,226
48 01/02 15,016,100 16,197,713,855
47 10/01 13,266,610 14,145,671,645
46 07/01 12,313,759 13,037,646,166
45 04/01 11,434,113 12,207,092,905 HTC division started
44 01/01 10,165,597 11,136,298,841
43 10/00 8,666,551 10,034,532,698
42 07/00 7,554,995 8,880,721,093
41 04/00 5,962,608 6,409,581,885 CON division started
40 01/00 5,388,125 4,762,696,173 RNA division terminated
39 10/99 4,810,773 3,728,000,562 NID and PID discarded
38 07/99 4,294,369 3,098,519,597
37 03/99 3,311,627 2,375,261,951 VERSION, /protein_id started
36 01/99 3,073,166 2,190,425,560
35 10/98 2,759,261 1,957,341,169
34 07/98 2,412,785 1,708,580,623
33 04/98 2,174,769 1,479,303,279
32 01/98 1,956,669 1,300,950,613
31 10/97 1,731,532 1,139,869,464 Adoption of the unified taxonomy
database
30 07/97 1,534,115 992,788,339 NID and PID terminated
29 04/97 1,270,194 841,415,232
28 01/97 1,154,120 756,785,219 HTG division started
ORG division terminated
27 10/96 936,697 608,103,057 GSS division started
26 07/96 835,552 551,932,448
25 04/96 744,490 499,300,364 /translation started
24 01/96 637,508 431,771,652
23 10/95 569,757 390,694,350
22 07/95 437,588 322,982,425 HUM division started
21 04/95 274,596 250,875,023
20 01/95 239,689 231,299,557
19 10/94 204,332 205,274,131
18 07/94 185,230 192,473,021
17 04/94 169,957 179,942,209
16 01/94 154,626 165,017,628
15 10/93 131,649 147,224,690
14 07/93 120,350 138,686,333
13 04/93 112,067 129,784,445
12 01/93 97,683 120,815,244 EST division started
11 07/92 65,693 84,839,075
10 01/92 59,317 77,805,556 GenBank/EMBL inclusion started
9 07/91 1,130 2,002,124
8 01/91 879 1,573,442
7 07/90 681 1,154,211
6 01/90 496 841,236
5 07/89 395 679,378
4 01/89 302 535,985
3 07/88 230 345,850
2 01/88 142 199,392
1 07/87 66 108,970 Started with DDBJ only
------------------------------------------------------------------------
This release covers 20 categories of organisms and others as follows:
------------------------------------------------------------------------------
ddbjbct.*** Category for bacteria
ddbjest.*** Category for EST (expressed sequence tag)
ddbjcon.*** Category for CON (Contig sequences)
ddbjhtc.*** Category for HTC (high throughput cDNA)
ddbjhtg.*** Category for HTG (high throughput genomic sequence)
ddbjhum.*** Category for human
ddbjgss.*** Category for GSS (Genome Survey Sequence)
ddbjinv.*** Category for invertebrates
ddbjmam.*** Category for mammals other than primates and rodents
ddbjpat.*** Category for patents
ddbjphg.*** Category for phages
ddbjpln.*** Category for plants
ddbjpri.*** Category for primates other than human
ddbjrod.*** Category for rodents
ddbjsts.*** Category for STS (sequence tagged site)
ddbjsyn.*** Category for synthetic DNAs
ddbjtpa.*** Category for TPA (Third Party Annotation)
ddbjuna.*** Category for unannotated sequences
ddbjvrl.*** Category for viruses
ddbjvrt.*** Category for vertebrates other than mammals
------------------------------------------------------------------------------
Each category then has the following nine files. Note that all the files
except for ddbj***.seq are created by the user by use of seq2indexes as
mentioned in the release note.
------------------------------------------------------------------------------
ddbj***.seq List of an entry in DDBJ format, see Table 1.
ddbj***.acc List of the accession numbers, see Table 2 .
ddbj***.aut List of the authors, see Table 3.
ddbj***.dir List of the short directory in DDBJ style, see Table 4.
ddbj***.idx List of indices, see Table 5.
ddbj***.jou List of the journals, see Table 6.
ddbj***.key List of the key words, see Table 7.
ddbj***.org List of the species names, see Table 8.
ddbj***.sdr List of the short directory in DDBJ style, see Table 9.
------------------------------------------------------------------------------
The format of LOCUS line in the flat file was changed as shown below
to adjust to the GenBank format from release 51.
------------------------------------------------------------------------------
Old (-rel. 50):
LOCUS AB000001 660 bp DNA PLN 01-FEB-2001
Present (rel. 51-):
LOCUS AB000001 660 bp DNA linear PLN 01-FEB-2001
New format specification:
--------- --------
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), mRNA
(messenger RNA), uRNA (small nuclear RNA), scRNA, snRNA, snoRNA.
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
------------------------------------------------------------------------------
Table 1. Part of the contents in the file 'ddbjbct.seq'.
This shows all pieces of information on one entry in DDBJ format.
------------------------------------------------------------------------------
LOCUS D87069 993 bp mRNA linear BCT 14-APR-2000
DEFINITION Escherichia coli mRNA for RNA polymerase sigma subunit, truncated
form of sigma-38, complete cds.
ACCESSION D87069
VERSION D87069.1
KEYWORDS RNA polymerase sigma subunit, truncated form of sigma-38.
SOURCE Escherichia coli
ORGANISM Escherichia coli
Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;
Escherichia.
REFERENCE 1 (bases 1 to 993)
AUTHORS Jishage,M.
TITLE Direct Submission
JOURNAL Submitted (14-AUG-1996) to the DDBJ/EMBL/GenBank databases. Miki
Jishage, National Institute of Genetics, Molecular Genetics; Yata
1111, Mishima, Shizuoka 411, Japan (E-mail:mjishage@lab.nig.ac.jp,
Tel:0559-81-6742, Fax:0559-81-6746)
REFERENCE 2 (bases 1 to 993)
AUTHORS Jishage,M. and Ishihama,A.
TITLE Variation in RNA polymerase sigma subunit composition within
different stocks of Escherichia coli starin W3110
JOURNAL Unpublished (1996)
REFERENCE 3
AUTHORS Ivanova,A., Renshaw,M., Guntaka,R. and Eisenstark,A.
TITLE DNA base sequence variability in katF (putative sigma factor) gene
Escherichia coli
JOURNAL Nucleic Acids Res. 20, 5479-5480 (1992)
REFERENCE 4
AUTHORS Takayanagi,Y., Tanaka,K. and Takahashi,H.
TITLE Structure of the 5' upstream region and the regulation of the rpoS
gene of Escherichia coli
JOURNAL Mol. Gen. Genet. 243, 525-531 (1994)
COMMENT
FEATURES Location/Qualifiers
source 1..993
/mol_type="mRNA"
/organism="Escherichia coli"
/strain="W3110"
CDS 1..810
/note="the gene has four single base changes, resulting
in two amino acid substitutions and an amber mutation"
/product="RNA polymerase sigma subunit, truncated form of
sigma-38"
/protein_id="BAA13238.1"
/transl_table=11
/translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEYEPSDNDLAEEE
LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV
VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN
QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER
ITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAK"
variation 75
/citation=[3]
/replace="t"
variation 97
/citation=[3]
/replace="t"
variation 99
/citation=[3]
/replace="t"
variation 808
/citation=[3]
/replace="t"
BASE COUNT 254 a 223 c 291 g 225 t
ORIGIN
1 atgagtcaga atacgctgaa agttcatgat ttaaatgaag atgcggaatt tgatgagaac
61 ggagttgagg tttttgacga aaaggcctta gtagaatatg aacccagtga taacgatttg
121 gccgaagagg aactgttatc gcagggagcc acacagcgtg tgttggacgc gactcagctt
181 taccttggtg agattggtta ttcaccactg ttaacggccg aagaagaagt ttattttgcg
241 cgtcgcgcac tgcgtggaga tgtcgcctct cgccgccgga tgatcgagag taacttgcgt
301 ctggtggtaa aaattgcccg ccgttatggc aatcgtggtc tggcgttgct ggaccttatc
361 gaagagggca acctggggct gatccgcgcg gtagagaagt ttgacccgga acgtggtttc
421 cgcttctcaa catacgcaac ctggtggatt cgccagacga ttgaacgggc gattatgaac
481 caaacccgta ctattcgttt gccgattcac atcgtaaagg agctgaacgt ttacctgcga
541 accgcacgtg agttgtccca taagctggac catgaaccaa gtgcggaaga gatcgcagag
601 caactggata agccagttga tgacgtcagc cgtatgcttc gtcttaacga gcgcattacc
661 tcggtagaca ccccgctggg tggtgattcc gaaaaagcgt tgctggacat cctggccgat
721 gaaaaagaga acggtccgga agataccacg caagatgacg atatgaagca gagcatcgtc
781 aaatggctgt tcgagctgaa cgccaaatag cgtgaagtgc tggcacgtcg attcggtttg
841 ctggggtacg aagcggcaac actggaagat gtaggtcgtg aaattggcct cacccgtgaa
901 cgtgttcgcc agattcaggt tgaaggcctg cgccgtttgc gcgaaatcct gcaaacgcag
961 gggctgaata tcgaagcgct gttccgcgag taa
//
------------------------------------------------------------------------------
Table 2. Part of the contents in the file 'ddbjbct.acc'.
The first column refers to the secondary accession number, second column to
the locus name, and third to the primary accession number. The primary number
may be the same as the secondary number. They are arranged in the ascending
order of the secondary accession numbers.
------------------------------------------------------------------------------
D00001 -> ECOPBPAA X04516
D00002 -> ECOPYRH X04469
D00006 -> PNS981TET D00006
D00020 -> COLE2LYS D00020
D00021 -> COLE31YS D00021
D00038 -> BRLAM330 D00038
D00066 -> BAC139AC D00066
D00067 -> ECONANA M20207
D00069 -> ECOUVRD2 D00069
D00087 -> BACXYNAA D00087
------------------------------------------------------------------------------
Table 3. Part of the contents in the file 'ddbjbct.aut'.
For each author name given on the left to the arrow, the corresponding locus
name and primary accession number are respectively listed on the right. They
are arranged in the alphabetical order of the author names.
------------------------------------------------------------------------------
Aan,F. -> STYCRR X05210
Aan,F. -> STYENZI M76176
Aaronson,W. -> ECOKPSD M64977
Aaronson,W. -> ECONEUA J05023
Abad-Lapuebla,M.A. -> VIBTDHI D90238
Abdel-Mawgood,A.L. -> CYAPSBHA X16394
Abdel-Meguid,S.S. -> TRNGDRECM J01843
Abdelal,A. -> STYCARA M36540
Abdelal,A. -> STYCARAB X13200
Abdelal,A.H. -> PSENOSA M60717
------------------------------------------------------------------------------
Table 4. Part of the short directory in DDBJ style in the file 'ddbjbct.dir'.
For each locus name given in the first column, the corresponding primary
accession number, molecular type, number of nucleotide pairs, and description
for the locus are respectively listed. They are arranged in the alphabetical
order of the locus names.
------------------------------------------------------------------------------
ABCAARAA M34830 ds-DNA 1624 A.aceti acetic acid resistance protein (aarA)
gene, complete cds.
ABCADHCC D00635 ds-DNA 4230 A. polyoxogenes alcohol dehydrogenase (EC
1.1.99.8) and cytochrome c genes.
ABCALDH D00521 ds-DNA 2683 A.polyoxogenes membrane-bound aldehyde
dehydrogenase gene, complete cds and flanks.
ABCBCSAA M37202 ds-DNA 9540 A.xylinum bcs B, bcs C and bcs D genes,
complete cds and bcs A gene, partial cds.
ABCCELA M76548 ds-DNA 1165 Acetobacter xylinum UDP pyrophosphorylase
(celA) gene, complete cds.
ABCCELSYN X54676 ds-DNA 5363 A. xylinum gene for cellulose biosynthesis
ABCIS1380 D10043 ds-DNA 1665 A.pasteurianus insertion sequence IS1380.
ACAADH1 D90004 ds-DNA 2467 Acetobacter aceti(K6033) alcohol dehydrogenase
subunit gene(adh1).
ACCAAC2 M62833 ds-DNA 1123 Acinetobacter baumannii aminoglycoside
acetyltr ansferase (aac2) gene, complete cds.
ACCACEAA M62822 ds-DNA 1874 A.baumannii chloramphenicol acetyltransferase
(cat) gene, complete cds.
------------------------------------------------------------------------------
Table 5. Part of the contents in the file 'ddbjbct.idx'.
The first column refers to the locus name, second column to the starting site
of the locus in byte, and third to its ending site in byte. They are arranged
in the alphabetical order of the locus names.
------------------------------------------------------------------------------
%*****************************
#ABCAARAA 0 3211
#ABCADHCC 3212 10608
#ABCALDH 10609 15864
#ABCBCSAA 15865 29583
#ABCCELA 29584 32289
#ABCCELSYN 32290 40960
#ABCIS1380 40961 44711
#ACAADH1 44712 49357
#ACCAAC2 49358 52395
------------------------------------------------------------------------------
Table 6. Part of the contents in the file 'ddbjbct.jou'.
This gives information on the journal in which sequence data were published.
------------------------------------------------------------------------------
(in) Chaloupka,J. and Krumphanzl,V. (Eds.); Extracellular Enzymes of
Microorganisms: 129-137, Plenum Press, New York (1987) -> BACAMYABS M57457
(in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene
Regulation in Bacilli: 3-10, Academic Press, New York (1982) -> BACRG16S
M55011
(in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene
Regulation in Bacilli: 3-10, Academic Press, New York (1982) -> BACRG16SA
M55006
(in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene
Regulation in Bacilli: 3-10, Academic Press, New York (1982) -> BACRG16SB
M55008
(in) Hoch,J.A. and Setlow,P. (Eds.); Molecular Biology of Microbial
Differentiation: 85-94, American Society for Microbiology, Washington, DC
(1985) -> BACSPOII M57606
(in) Holmgren,A. (Ed.); Thioredoxin and Glutaredoxin Systems: Structure and
Function: 11-19, Unknown name, Unknown city (1986) -> ECOTRXA1 M54881
(in) Kjeldgaard,N.C. and Maaloe,O. (Eds.); Control of ribosome synthesis:
138-143, Academic Press, New York (1976) -> ECOLAC J01636
(in) Losick,R. and Chamberlin,M. (Eds.); RNA polymerase: 455-472, Cold
Spring Harbor Laboratory, Cold Spring Harbor, NY (1976) -> ECOTGY1 K01197
(in) Sikes,C.S. and Wheeler,A.P. (Eds.); Surface reactive peptides and
polymers. Discovery and commercialization.: 186-200, American Chemical
Society, Washington, D.C. (1991) -> ECOTGP J01714
(in) Sund,H. and Blauer,G. (Eds.); Protein-Ligand Interactions: 193-207,
Walter de Gruyter, New York (1975) -> ECOLAC J01636
(in) Wu,R. and Grossman,L. (Eds.); Methods in Enzymology, Recombinant DNA,
part E: In press, Academic Press, New York, N.Y. (1986) -> PLMCG M11320
Acta Microbiol. Pol. 35, 175-190 (1986) -> ECOTGG1 M54893
Actinomycetologica 5, 14-17 (1991) -> STMARGG D00799
Adv. Biophys. 21, 115-133 (1986) -> R10REP M26840
Adv. Biophys. 21, 175-192 (1986) -> ECONUSAA M26839
Adv. Enzyme Regul. 21, 225-237 (1983) -> ECOPURFA M26893
Adv. Exp. Med. Biol. 195, 239-246 (1986) -> ECOAPT M14040
Agric. Biol. Chem. 50, 2155-2158 (1986) -> ECONANA M20207
Agric. Biol. Chem. 50, 2771-2778 (1986) -> BRLAM330 D00038
Agric. Biol. Chem. 51, 2019-2022 (1987) -> BACCGT D00129
Agric. Biol. Chem. 51, 2641-2648 (1987) -> STRSAGP D00219
Agric. Biol. Chem. 51, 2807-2809 (1987) -> BACPGECR M35503
Agric. Biol. Chem. 51, 3133-3135 (1987) -> BACXYLAP D00312
Agric. Biol. Chem. 51, 455-463 (1987) -> BACHDCRY D00117
Agric. Biol. Chem. 51, 953-955 (1987) -> BACXYNAA D00087
Agric. Biol. Chem. 52, 1565-1573 (1988) -> BACIP135 D00348
Agric. Biol. Chem. 52, 1785-1789 (1988) -> BACTMR D00343
Agric. Biol. Chem. 52, 2243-2246 (1988) -> PSEGI D00342
Agric. Biol. Chem. 52, 399-406 (1988) -> BACAMYEB M35517
Agric. Biol. Chem. 52, 479-487 (1988) -> ECAPALI D00217
------------------------------------------------------------------------------
Table 7. Part of the contents in the file 'ddbjbct.key'.
For the locus and accession number respectively given on the right to the
arrow, the corresponding key words are listed on the left.
------------------------------------------------------------------------------
A.aceti acetic acid resistance protein (aarA) gene, complete cds. -> ABCAARAA
M34830
acetic acid resistance protein. -> ABCAARAA M34830
Cloning of genes responsible for acetic acid resistance in acetobacter aceti
-> ABCAARAA M34830
A. polyoxogenes alcohol dehydrogenase (EC 1.1.99.8) and cytochrome c genes.
-> ABCADHCC D00635
alcohol dehydrogenase; cytochrome c. -> ABCADHCC D00635
Cloning and sequencing of the gene cluster encoding two subunits of membrane-
bound alcohol dehydrogenase from Acetobacter polyoxogenes -> ABCADHCC
D00635
These data kindly submitted in computer readable form by: Toshimi Tamaki
Nakano Central Biochemical Institute 2-6 Nakamura-cho Handa-shi, Aichi-ken
475 Japan Phone: 0569-21-3331 Fax: 0569-23-8486 -> ABCADHCC D00635
A.polyoxogenes membrane-bound aldehyde dehydrogenase gene, complete cds and
flanks. -> ABCALDH D00521
aldehyde dehydrogenase gene; ethanol oxidation; membrane-bound enzyme. -> ABCALDH
D00521
Nucleotide sequence of the membrane-bound aldehyde dehydrogenase gene from
Acetobacter polyoxogenes -> ABCALDH D00521
------------------------------------------------------------------------------
Table 8. Part of the contents in the file 'ddbjbct.org'.
For the locus and accession number respectively given on the right to the
arrow, the corresponding taxonomic names are listed on the left. They are
arranged in the alphabetical order of the species names.
------------------------------------------------------------------------------
A. nidulans 6301 DNA. Anacystis nidulans Prokaryota; Bacteria; Gracilicutes;
Oxyphotobacteria; Cyanobacteria. -> ANIRUBPS X00019
A. nidulans DNA, clone pAN4. Anacystis nidulans Prokaryota; Bacteria;
Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> ANIRGGX X00343
A. nidulans DNA. Anacystis nidulans Prokaryota; Bacteria; Gracilicutes;
Oxyphotobacteria; Cyanobacteria. -> ANIRGG X00512
A. polyoxogenes genomic DNA. Acetobacter polyoxogenes Prokaryota; Bacteria;
Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. -
> ABCADHCC D00635
A. quadruplicatum (strain PR-6) DNA, clone pAQPR1. Agmenellum quadruplicatum
Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> AQUPCAB
K02660
A. quadruplicatum (strain PR6) DNA. Agmenellum quadruplicatum Prokaryota;
Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria. -> AQUCPCAB
K02659
A. vinelandii DNA. Azotobacter vinelandii Prokaryota; Bacteria; Gracilicutes;
Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. -> AVINIFUSV
M17349
A.aceti (strain 10-8) DNA, clone pAR1611. Acetobacter aceti Prokaryota;
Bacteria; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae. -> ABCAARAA M34830
A.actinomycetemcomitans (strain JP2) DNA, clone lambda-OP8. Actinobacillus
actinomycetemcomitans Prokaryota; Bacteria; Gracilicutes; Scotobacteria;
Facultatively anaerobic rods; Pasteurellaceae. -> ACNLKTXN M27399
A.anitratum DNA, clone pLJD1. Acinetobacter anitratum Prokaryota; Bacteria;
Gracilicutes; Scotobacteria; Neisseriaceae. -> ACCCITSYN M33037
------------------------------------------------------------------------------
Table 9. Part of the short directory file in DDBJ style in the file
'ddbjbct.sdr'.
The short directory file contains brief descriptions of all of the sequence
entries contained in the DDBJ style.
------------------------------------------------------------------------------
ABCAARAA A.aceti acetic acid resistance protein (aarA) gene, complete 1624bp
ABCADHCC A. polyoxogenes alcohol dehydrogenase (EC 1.1.99.8) and 4230bp
ABCALDH A.polyoxogenes membrane-bound aldehyde dehydrogenase gene, 2683bp
ABCBCSABCD A.xylinum bcs A, B, C and D genes, complete cds's. 9540bp
ABCCELA Acetobacter xylinum UDP pyrophosphorylase (celA) gene, 1165bp
ABCCELSYN A. xylinum gene for cellulose biosynthesis 5363bp
ABCIS1380 A.pasteurianus insertion sequence IS1380. 1665bp
ACAADH1 Acetobacter aceti(K6033) alcohol dehydrogenase subunit 2467bp
ACCAAC2 Acinetobacter baumannii aminoglycoside acetyltransferase 1123bp
ACCACEAA A.baumannii chloramphenicol acetyltransferase (cat) gene, 1874bp
ACCAPHA6 Acinetobacter baumannii aphA-6 gene. 1170bp
ACCBENABCA A.calcoaceticus BenA, BenB, BenC, BenD, and BenE proteins 15922bp
ACCCAT Acinetobacter calcoaceticus cat operon. 15922bp
ACCCATAM A.calcoaceticus catA and catM genes, encoding catechol 1, 5537bp
ACCCHMO Acinetobacter sp. cyclohexanone monooxygenase gene, complete 2128bp
ACCCITSYN A.anitratum citrate synthase gene, complete cds. 1895bp
------------------------------------------------------------------------------
In addition to the 9 tables the four following index files are included in
this release. These files were prepared irrespective of the 10 categories of
taxonomic divisions.
Accession number index file
Keyword phrase index file
Journal citation index file
Gene name index file
A brief description is given for each file in the following.
Table 10. Part of the accession number index file in the 'ddbjacc.idx'.
The following excerpt from the accession number index file illustrates the
format of the index.
------------------------------------------------------------------------------
D00100 PSEASPAA BCT D00100
D00101 RABNP450R MAM D00101
D00102 HUMLTX HUM D00102
D00103 AFARRN5SA BCT D00103 AFRRN5SA BCT X05517
D00104 AFARRN5SB BCT D00104 AFRRN5SB BCT X05518
D00105 AFARRN5S BCT D00105 ASRRN5S BCT X05524
D00106 ACH5SRR BCT D00106 AXRRN5S BCT X05522 AXRRN5SA BCT X05523
D00107 ACH5SRRX BCT D00107 ACRRN5S BCT X05521
------------------------------------------------------------------------------
Table 11. Part of the keyword phrase index file in the 'ddbjkey.idx'.
Keyword phrases consist of names for gene products and other characteristics
of sequence entries.
------------------------------------------------------------------------------
A CHANNEL
DROCHA INV M17155
A COMPONENT
SQLCVEA VRL M38183
A LOCUS
GORGOGOA3 PRI X54375 GORGOGOA4 PRI X54376
A LOCUS ALLELE
GORA0101 PRI X60258 GORA0201 PRI X60259 GORA0401 PRI X60257
GORA0501 PRI X60256
A MULTI-GENE FAMILY
RICGLUTE PLN D00584
A PROTEIN
MS2AAR PHG M25187 ST1APCS PHG M25396
A SEQUENCE
HS5TOA30 VRL D00148 HS5TOA31 VRL D00147
------------------------------------------------------------------------------
Table 12. Part of the journal citation index file in 'ddbjjou.idx'.
The journal citation index file lists all of the citations that appear in the
references.
------------------------------------------------------------------------------
ACTA BIOCHIM. BIOPHYS. SIN. 23, 246-253 (1992)
HUMPLASINS HUM M98056
ACTA BIOCHIM. BIOPHYS. SIN. 28, 233-239(1996)
TKTII PLN X82230
ACTA BIOCHIM. POL. 24, 301-318 (1977)
LUPTRFJ PLN K00345 LUPTRFN PLN K00346
ACTA BIOCHIM. POL. 26, 369-381(1979)
HVTRNPHE PLN X02683
ACTA BIOCHIM. POL. 29, 143-149 (1982)
EMEMTA PLN M32572 EMEMTB PLN M32573 EMEMTC PLN M32574
EMEMTD PLN M32575 EMEMTE PLN M32576
ACTA BIOCHIM. POL. 34, 21-27 (1987)
LUPNOSP PLN M32571
------------------------------------------------------------------------------
Table 13. Part of the gene name index file in 'ddbjgen.idx'.
This file lists all the gene names that appear in the feature table.
------------------------------------------------------------------------------
AACC8
STMAACC8 BCT M55426
AACC9
MPUAACC9 BCT M55427
AACT
HUMA1ACM PRI K01500 HUMA1ACMA PRI X00947 HUMA1ACMB PRI M18035
HUMAACT1 PRI M18906 HUMAACT2 PRI M22533 HUMAACTA PRI J05176
AAD
INTINTORF BCT L06418 LMOMO229D BCT X17478
AAD A1
ENTAAC3VI BCT M88012
AAD9
ENEAAD9A BCT M69221
AADA
LMOMO229A BCT X17479 S52249 BCT S52249 SYNAADA SYN M60473
TRNTAAB BCT M55547 TRNTN21CAS BCT M86913
------------------------------------------------------------------------------
The files in this release are arranged in the following order with
non-labeled format.
Category number of number of file name file size
entries bases
Release note ddbjrel.txt 72421
bacteria1 28325 120321805 ddbjbct1.seq 299041039
bacteria2 6877 130913011 ddbjbct2.seq 299625645
bacteria3 48591 116187543 ddbjbct3.seq 299002020
bacteria4 53564 108026785 ddbjbct4.seq 299146839
bacteria5 26732 130949801 ddbjbct5.seq 299001618
bacteria6 40062 118220823 ddbjbct6.seq 299034729
bacteria7 36927 73278934 ddbjbct7.seq 195030845
CON 16190 0 ddbjcon.seq 64476558
EST1 90092 33919201 ddbjest1.seq 299000961
EST2 94909 38175564 ddbjest2.seq 299002718
EST3 95456 37053779 ddbjest3.seq 299000508
EST4 89429 28106820 ddbjest4.seq 299000560
EST5 94290 36413936 ddbjest5.seq 299001554
EST6 98428 39008125 ddbjest6.seq 298999953
EST7 98537 38046950 ddbjest7.seq 299002561
EST8 97457 37753782 ddbjest8.seq 299002153
EST9 98174 38758905 ddbjest9.seq 299002652
EST10 99189 38789629 ddbjest10.seq 299003488
EST11 97700 39026354 ddbjest11.seq 299000423
EST12 96811 43308671 ddbjest12.seq 299001170
EST13 105349 42364734 ddbjest13.seq 299001283
EST14 101826 41099262 ddbjest14.seq 299003242
EST15 97670 40980111 ddbjest15.seq 299001534
EST16 94481 42210153 ddbjest16.seq 299002230
EST17 96914 39088603 ddbjest17.seq 299000147
EST18 97882 42658046 ddbjest18.seq 299004040
EST19 96155 41859521 ddbjest19.seq 299002408
EST20 95217 38999913 ddbjest20.seq 299000808
EST21 108545 52137587 ddbjest21.seq 299000013
EST22 111728 48896188 ddbjest22.seq 299001992
EST23 87286 85526985 ddbjest23.seq 299001653
EST24 116794 65583557 ddbjest24.seq 299000215
EST25 121475 61839046 ddbjest25.seq 299001244
EST26 130980 57080290 ddbjest26.seq 299000985
EST27 118494 64902719 ddbjest27.seq 299000389
EST28 108972 40758262 ddbjest28.seq 299000618
EST29 92298 24565620 ddbjest29.seq 299002638
EST30 90996 26764564 ddbjest30.seq 299002389
EST31 60443 16481599 ddbjest31.seq 299004105
EST32 60484 16640500 ddbjest32.seq 299004346
EST33 87296 32643401 ddbjest33.seq 299001423
EST34 120643 55014293 ddbjest34.seq 299001735
EST35 108061 55947754 ddbjest35.seq 299002540
EST36 107101 51689093 ddbjest36.seq 299000708
EST37 130072 67170348 ddbjest37.seq 299000018
EST38 95710 41510347 ddbjest38.seq 299002088
EST39 90014 39411004 ddbjest39.seq 299003370
EST40 92153 39779173 ddbjest40.seq 299003249
EST41 100668 40521609 ddbjest41.seq 299001954
EST42 94983 37475239 ddbjest42.seq 299004742
EST43 82657 36839963 ddbjest43.seq 299002996
EST44 95238 42242180 ddbjest44.seq 299001038
EST45 97731 44051113 ddbjest45.seq 299002078
EST46 96534 35230455 ddbjest46.seq 299002153
EST47 108718 48050677 ddbjest47.seq 299000562
EST48 65614 19861170 ddbjest48.seq 299002217
EST49 60263 17458591 ddbjest49.seq 299000774
EST50 60358 18578773 ddbjest50.seq 299002435
EST51 60336 18871594 ddbjest51.seq 299000531
EST52 60377 18879591 ddbjest52.seq 299003091
EST53 60316 18056516 ddbjest53.seq 299002079
EST54 60922 18612781 ddbjest54.seq 299004405
EST55 61716 18733046 ddbjest55.seq 299002618
EST56 61578 19477313 ddbjest56.seq 299002320
EST57 62322 17535094 ddbjest57.seq 299003395
EST58 58200 34288170 ddbjest58.seq 299002263
EST59 55021 25365800 ddbjest59.seq 299000006
EST60 54706 23956145 ddbjest60.seq 299000685
EST61 54641 22696502 ddbjest61.seq 299000457
EST62 60969 24714667 ddbjest62.seq 299000471
EST63 93636 39647263 ddbjest63.seq 299001130
EST64 95830 38725336 ddbjest64.seq 299001947
EST65 97181 54946005 ddbjest65.seq 299001214
EST66 99128 52971185 ddbjest66.seq 299002350
EST67 98017 47328413 ddbjest67.seq 299000136
EST68 94230 52748330 ddbjest68.seq 299002902
EST69 94746 45311468 ddbjest69.seq 299000533
EST70 95720 56281946 ddbjest70.seq 299000270
EST71 93706 47761334 ddbjest71.seq 299001265
EST72 89337 52662612 ddbjest72.seq 299000460
EST73 90439 44617577 ddbjest73.seq 299001932
EST74 95293 57872912 ddbjest74.seq 299001077
EST75 89972 54054638 ddbjest75.seq 299003087
EST76 94878 54224552 ddbjest76.seq 299001860
EST77 91523 38695020 ddbjest77.seq 299001831
EST78 85215 45538682 ddbjest78.seq 299002426
EST79 83780 45644590 ddbjest79.seq 299000190
EST80 92444 57193284 ddbjest80.seq 299000141
EST81 97200 42632063 ddbjest81.seq 299000917
EST82 95833 34453585 ddbjest82.seq 299002352
EST83 95148 42725413 ddbjest83.seq 299002201
EST84 85325 43976514 ddbjest84.seq 299002269
EST85 102518 62027104 ddbjest85.seq 299000662
EST86 98047 59443458 ddbjest86.seq 299003085
EST87 87842 52266091 ddbjest87.seq 299000673
EST88 93152 62969736 ddbjest88.seq 299000873
EST89 89678 56093750 ddbjest89.seq 299000964
EST90 95649 54016870 ddbjest90.seq 299001509
EST91 94353 63697734 ddbjest91.seq 299000758
EST92 93871 62843647 ddbjest92.seq 299003468
EST93 100080 53269195 ddbjest93.seq 299000987
EST94 97365 36621768 ddbjest94.seq 299000366
EST95 103828 61246546 ddbjest95.seq 299000299
EST96 96246 57340973 ddbjest96.seq 299002836
EST97 84241 41285454 ddbjest97.seq 299000853
EST98 88290 48500773 ddbjest98.seq 299001687
EST99 84978 46677839 ddbjest99.seq 299001900
EST100 91763 55415253 ddbjest100.seq 299001568
EST101 91825 57120185 ddbjest101.seq 299002211
EST102 86067 49788005 ddbjest102.seq 299002204
EST103 95777 55925109 ddbjest103.seq 299000794
EST104 79560 48284779 ddbjest104.seq 299003136
EST105 108344 58717871 ddbjest105.seq 299001502
EST106 105235 59716763 ddbjest106.seq 299003859
EST107 109040 56758571 ddbjest107.seq 299001370
EST108 130693 69679809 ddbjest108.seq 299000393
EST109 119963 66954898 ddbjest109.seq 299001228
EST110 95763 56801800 ddbjest110.seq 299001295
EST111 90316 52389728 ddbjest111.seq 299002702
EST112 85278 39545231 ddbjest112.seq 299000242
EST113 72616 33825914 ddbjest113.seq 299004457
EST114 82479 40362278 ddbjest114.seq 299002001
EST115 73268 38083970 ddbjest115.seq 299001688
EST116 100053 66782871 ddbjest116.seq 299003131
EST117 85674 55981720 ddbjest117.seq 299000235
EST118 95101 54701853 ddbjest118.seq 299001011
EST119 79569 39442715 ddbjest119.seq 299000909
EST120 84270 49539744 ddbjest120.seq 299001501
EST121 83011 54261221 ddbjest121.seq 299002409
EST122 91145 50968092 ddbjest122.seq 299001367
EST123 103359 59441714 ddbjest123.seq 299001081
EST124 91157 51126337 ddbjest124.seq 299001779
EST125 86898 56044390 ddbjest125.seq 299003105
EST126 76524 44446511 ddbjest126.seq 299001917
EST127 88782 53399984 ddbjest127.seq 299001630
EST128 96240 37352886 ddbjest128.seq 299002465
EST129 92357 55936450 ddbjest129.seq 299001121
EST130 93244 47100607 ddbjest130.seq 299002714
EST131 88730 52509598 ddbjest131.seq 299003248
EST132 90007 63346315 ddbjest132.seq 299000753
EST133 86830 45462759 ddbjest133.seq 299000324
EST134 88953 66873345 ddbjest134.seq 299003179
EST135 87519 51786666 ddbjest135.seq 299001729
EST136 92243 53345033 ddbjest136.seq 299001713
EST137 89777 74190595 ddbjest137.seq 299003565
EST138 82166 60443077 ddbjest138.seq 299000498
EST139 81645 60362295 ddbjest139.seq 299000587
EST140 83632 59042956 ddbjest140.seq 299000937
EST141 84408 63463446 ddbjest141.seq 299002295
EST142 79710 50730543 ddbjest142.seq 299001375
EST143 81943 44340704 ddbjest143.seq 299001681
EST144 88504 50633653 ddbjest144.seq 299001404
EST145 112621 67542741 ddbjest145.seq 299000749
EST146 92155 56679634 ddbjest146.seq 299001941
EST147 132048 82832097 ddbjest147.seq 299001056
EST148 136058 81395469 ddbjest148.seq 299001973
EST149 101046 58418578 ddbjest149.seq 299001148
EST150 79873 58622384 ddbjest150.seq 299001540
EST151 85948 88451256 ddbjest151.seq 299002416
EST152 96781 62554188 ddbjest152.seq 299002164
EST153 101800 57202756 ddbjest153.seq 299002376
EST154 101227 72215766 ddbjest154.seq 299001735
EST155 76444 44149009 ddbjest155.seq 299001849
EST156 58766 22033581 ddbjest156.seq 299005859
EST157 56680 20013443 ddbjest157.seq 299002733
EST158 57265 20796821 ddbjest158.seq 299004856
EST159 56464 21509752 ddbjest159.seq 299002985
EST160 56100 23433589 ddbjest160.seq 299000994
EST161 57960 19655470 ddbjest161.seq 299002118
EST162 58630 23064118 ddbjest162.seq 299003329
EST163 56818 24029416 ddbjest163.seq 299002468
EST164 55590 23047045 ddbjest164.seq 299003716
EST165 55708 23753025 ddbjest165.seq 299004897
EST166 56410 22822723 ddbjest166.seq 299004715
EST167 56324 22149654 ddbjest167.seq 299003190
EST168 53023 35983521 ddbjest168.seq 299005622
EST169 93763 36103872 ddbjest169.seq 299001047
EST170 112781 54826478 ddbjest170.seq 299003000
EST171 88623 57371605 ddbjest171.seq 299000419
EST172 89331 57405127 ddbjest172.seq 299000845
EST173 86207 54132901 ddbjest173.seq 299002426
EST174 99048 56459045 ddbjest174.seq 299003269
EST175 87238 53284652 ddbjest175.seq 299001019
EST176 86633 42909915 ddbjest176.seq 299001566
EST177 127884 59468193 ddbjest177.seq 299003074
EST178 94031 52785998 ddbjest178.seq 299002760
EST179 85407 41183895 ddbjest179.seq 299002366
EST180 87696 53851099 ddbjest180.seq 299001174
EST181 93497 43779264 ddbjest181.seq 299002101
EST182 91199 53987885 ddbjest182.seq 299001394
EST183 84674 46010902 ddbjest183.seq 299000199
EST184 87921 48115638 ddbjest184.seq 299002970
EST185 110162 59023582 ddbjest185.seq 299000653
EST186 102996 67749756 ddbjest186.seq 299002081
EST187 111531 68568963 ddbjest187.seq 299000466
EST188 125764 59793838 ddbjest188.seq 299000101
EST189 97133 57137878 ddbjest189.seq 299003314
EST190 93562 52618603 ddbjest190.seq 299002131
EST191 95039 43084017 ddbjest191.seq 299001799
EST192 93252 47994583 ddbjest192.seq 299000329
EST193 79860 45911571 ddbjest193.seq 299002078
EST194 87076 52712379 ddbjest194.seq 299001940
EST195 86127 58522045 ddbjest195.seq 299000492
EST196 84039 44957262 ddbjest196.seq 299002470
EST197 111634 57705719 ddbjest197.seq 299002071
EST198 102288 59606017 ddbjest198.seq 299001429
EST199 142896 65964044 ddbjest199.seq 299000671
EST200 124966 55252878 ddbjest200.seq 299001674
EST201 87991 47201811 ddbjest201.seq 299000566
EST202 92133 59140799 ddbjest202.seq 299001577
EST203 101708 50719407 ddbjest203.seq 299001942
EST204 89556 55456112 ddbjest204.seq 299000724
EST205 79461 48799992 ddbjest205.seq 299003657
EST206 69394 38509847 ddbjest206.seq 299002097
EST207 83475 51066321 ddbjest207.seq 299000096
EST208 89657 51567669 ddbjest208.seq 299000377
EST209 85715 51854622 ddbjest209.seq 299000519
EST210 91379 63683650 ddbjest210.seq 299003157
EST211 81041 62488819 ddbjest211.seq 299000653
EST212 77953 43761617 ddbjest212.seq 299004201
EST213 94307 65397417 ddbjest213.seq 299002577
EST214 98431 49599292 ddbjest214.seq 299001570
EST215 84776 47634177 ddbjest215.seq 299003648
EST216 81095 42577945 ddbjest216.seq 299000719
EST217 111721 43023317 ddbjest217.seq 299001863
EST218 90069 32789652 ddbjest218.seq 299001315
EST219 95614 35213719 ddbjest219.seq 299002142
EST220 92948 33617312 ddbjest220.seq 298999946
EST221 100835 34544115 ddbjest221.seq 299000553
EST222 90025 37500543 ddbjest222.seq 299003032
EST223 32144 10738515 ddbjest223.seq 91081134
GSS1 104907 76505925 ddbjgss1.seq 299001393
GSS2 100338 71971324 ddbjgss2.seq 299000779
GSS3 117492 57578838 ddbjgss3.seq 299000914
GSS4 98687 75350490 ddbjgss4.seq 299000268
GSS5 82039 68875705 ddbjgss5.seq 299003149
GSS6 79662 73825737 ddbjgss6.seq 299003473
GSS7 82883 58769074 ddbjgss7.seq 299000789
GSS8 110434 45848265 ddbjgss8.seq 299001957
GSS9 117038 47829779 ddbjgss9.seq 299001170
GSS10 112945 52931845 ddbjgss10.seq 299002417
GSS11 102194 53418434 ddbjgss11.seq 299001263
GSS12 102384 52104662 ddbjgss12.seq 299002086
GSS13 98639 49559246 ddbjgss13.seq 299001722
GSS14 99989 50499503 ddbjgss14.seq 299001402
GSS15 92618 47262109 ddbjgss15.seq 299001562
GSS16 97173 54190471 ddbjgss16.seq 299002803
GSS17 89283 47603990 ddbjgss17.seq 299003422
GSS18 94936 55525483 ddbjgss18.seq 299000974
GSS19 91404 52423564 ddbjgss19.seq 299001010
GSS20 94198 47011880 ddbjgss20.seq 299001150
GSS21 94463 52692274 ddbjgss21.seq 299003138
GSS22 81865 38273791 ddbjgss22.seq 299002741
GSS23 73577 38001065 ddbjgss23.seq 299001453
GSS24 75568 32711521 ddbjgss24.seq 299000748
GSS25 84573 50272103 ddbjgss25.seq 299002941
GSS26 74885 34473637 ddbjgss26.seq 299000577
GSS27 89255 53261612 ddbjgss27.seq 299000936
GSS28 79491 31445103 ddbjgss28.seq 299002946
GSS29 81247 39296914 ddbjgss29.seq 299002791
GSS30 83077 42240884 ddbjgss30.seq 299003592
GSS31 93986 50019887 ddbjgss31.seq 299002332
GSS32 91808 59693030 ddbjgss32.seq 299001801
GSS33 100605 49598290 ddbjgss33.seq 299001667
GSS34 97688 52195793 ddbjgss34.seq 299000173
GSS35 108476 65357078 ddbjgss35.seq 299000875
GSS36 119466 79365122 ddbjgss36.seq 299001468
GSS37 115202 63463575 ddbjgss37.seq 299000158
GSS38 110386 52782792 ddbjgss38.seq 299001667
GSS39 107131 45280584 ddbjgss39.seq 299000465
GSS40 111299 74363470 ddbjgss40.seq 299000358
GSS41 117840 65789411 ddbjgss41.seq 299000070
GSS42 101344 62688168 ddbjgss42.seq 299000476
GSS43 93951 62917486 ddbjgss43.seq 299002680
GSS44 93050 61405280 ddbjgss44.seq 299002236
GSS45 101063 52416441 ddbjgss45.seq 299001704
GSS46 108059 70420006 ddbjgss46.seq 299001371
GSS47 111129 87545320 ddbjgss47.seq 299001392
GSS48 112101 64423188 ddbjgss48.seq 299001254
GSS49 114438 75500155 ddbjgss49.seq 299000565
GSS50 99012 56851234 ddbjgss50.seq 299000562
GSS51 102118 62897612 ddbjgss51.seq 299001237
GSS52 116914 55054461 ddbjgss52.seq 299002043
GSS53 111026 65480343 ddbjgss53.seq 299002197
GSS54 98320 85991213 ddbjgss54.seq 299000178
GSS55 96777 96645893 ddbjgss55.seq 299001762
GSS56 116531 85158105 ddbjgss56.seq 299000791
GSS57 85685 56444348 ddbjgss57.seq 299000421
GSS58 93639 65989881 ddbjgss58.seq 299001835
GSS59 114029 84526514 ddbjgss59.seq 299001853
GSS60 108818 66325622 ddbjgss60.seq 299002096
GSS61 114075 73866741 ddbjgss61.seq 299002416
GSS62 125503 72196941 ddbjgss62.seq 299000725
GSS63 127739 69522197 ddbjgss63.seq 299002350
GSS64 128601 68396595 ddbjgss64.seq 299000199
GSS65 130127 66407111 ddbjgss65.seq 299000150
GSS66 130224 66280561 ddbjgss66.seq 299001389
GSS67 130003 66568718 ddbjgss67.seq 299001431
GSS68 126163 71439227 ddbjgss68.seq 299001609
GSS69 114210 88613270 ddbjgss69.seq 299000173
GSS70 113168 89171245 ddbjgss70.seq 299002031
GSS71 111735 88586767 ddbjgss71.seq 299001921
GSS72 112604 80595229 ddbjgss72.seq 299001209
GSS73 121491 35542124 ddbjgss73.seq 299001590
GSS74 118953 46096445 ddbjgss74.seq 299000031
GSS75 104048 60614233 ddbjgss75.seq 299002580
GSS76 108900 70894048 ddbjgss76.seq 298999963
GSS77 105342 80532721 ddbjgss77.seq 299001279
GSS78 100330 101255713 ddbjgss78.seq 299001272
GSS79 108295 65861692 ddbjgss79.seq 299001576
GSS80 59585 39505822 ddbjgss80.seq 159393843
HTC1 37946 68171555 ddbjhtc1.seq 299002514
HTC2 47488 84572532 ddbjhtc2.seq 299002374
HTC3 85615 73123771 ddbjhtc3.seq 245841882
HTG1 1584 227725508 ddbjhtg1.seq 299235498
HTG2 3381 224532755 ddbjhtg2.seq 299191997
HTG3 3059 226010579 ddbjhtg3.seq 299002220
HTG4 1900 226002913 ddbjhtg4.seq 299123227
HTG5 1540 224771213 ddbjhtg5.seq 299241398
HTG6 1510 224843980 ddbjhtg6.seq 299106774
HTG7 1548 224594959 ddbjhtg7.seq 299202505
HTG8 1345 227888615 ddbjhtg8.seq 299018343
HTG9 1830 223027185 ddbjhtg9.seq 299314472
HTG10 1136 229941218 ddbjhtg10.seq 299349563
HTG11 897 230138044 ddbjhtg11.seq 299074970
HTG12 891 230123837 ddbjhtg12.seq 299071549
HTG13 957 229981984 ddbjhtg13.seq 299097551
HTG14 913 230255622 ddbjhtg14.seq 299273904
HTG15 1626 223381394 ddbjhtg15.seq 299033062
HTG16 1764 221665163 ddbjhtg16.seq 299137069
HTG17 1298 226838978 ddbjhtg17.seq 299094902
HTG18 1112 228437999 ddbjhtg18.seq 299162879
HTG19 953 229678136 ddbjhtg19.seq 299027052
HTG20 1162 228431515 ddbjhtg20.seq 299154153
HTG21 1069 229424515 ddbjhtg21.seq 299563856
HTG22 975 229608187 ddbjhtg22.seq 299216911
HTG23 996 229531217 ddbjhtg23.seq 299087913
HTG24 1035 229408431 ddbjhtg24.seq 299068052
HTG25 1114 228806415 ddbjhtg25.seq 299073263
HTG26 1173 228394226 ddbjhtg26.seq 299175447
HTG27 1118 228737874 ddbjhtg27.seq 299114303
HTG28 1182 228376784 ddbjhtg28.seq 299131138
HTG29 1065 229340291 ddbjhtg29.seq 299271452
HTG30 1057 229583831 ddbjhtg30.seq 299027390
HTG31 1200 228607396 ddbjhtg31.seq 299217650
HTG32 1051 229284651 ddbjhtg32.seq 299026461
HTG33 1033 229633497 ddbjhtg33.seq 299319249
HTG34 1033 229398693 ddbjhtg34.seq 299145722
HTG35 1109 228993773 ddbjhtg35.seq 299195433
HTG36 1147 229445394 ddbjhtg36.seq 298999952
HTG37 1144 228829616 ddbjhtg37.seq 299025993
HTG38 1244 228548444 ddbjhtg38.seq 299304327
HTG39 1437 226515061 ddbjhtg39.seq 299145289
HTG40 1439 228027906 ddbjhtg40.seq 299062567
HTG41 1381 228248953 ddbjhtg41.seq 299114996
HTG42 1366 227225867 ddbjhtg42.seq 299179827
HTG43 1321 229117583 ddbjhtg43.seq 299376834
HTG44 1451 229253122 ddbjhtg44.seq 299171226
HTG45 1422 230029444 ddbjhtg45.seq 299174602
HTG46 1452 229232404 ddbjhtg46.seq 298746685
HTG47 1290 230098935 ddbjhtg47.seq 301363685
HTG48 1476 230889439 ddbjhtg48.seq 299164208
HTG49 1270 231524413 ddbjhtg49.seq 299110544
HTG50 1201 232222430 ddbjhtg50.seq 299345607
HTG51 1244 230813135 ddbjhtg51.seq 299188137
HTG52 242 30207754 ddbjhtg52.seq 39335006
human1 12733 193350475 ddbjhum1.seq 299133164
human2 1612 212441790 ddbjhum2.seq 299182103
human3 1572 217307497 ddbjhum3.seq 299258369
human4 1351 206550698 ddbjhum4.seq 299276174
human5 1449 213575045 ddbjhum5.seq 299072185
human6 1464 210368255 ddbjhum6.seq 299026033
human7 1545 204265077 ddbjhum7.seq 299170718
human8 1638 213552902 ddbjhum8.seq 299104613
human9 1497 208468457 ddbjhum9.seq 299039938
human10 1797 209539412 ddbjhum10.seq 299043834
human11 1951 212875405 ddbjhum11.seq 299175177
human12 33930 168415784 ddbjhum12.seq 299001376
human13 68202 101327126 ddbjhum13.seq 299000139
human14 15979 171846295 ddbjhum14.seq 299108644
human15 3556 208102200 ddbjhum15.seq 299208452
human16 2118 216589197 ddbjhum16.seq 299139165
human17 2485 217193915 ddbjhum17.seq 299005855
human18 5235 219744232 ddbjhum18.seq 299053920
human19 1729 222590286 ddbjhum19.seq 299100599
human20 45472 95239815 ddbjhum20.seq 299008132
human21 133818 94357271 ddbjhum21.seq 299001742
human22 178943 72499462 ddbjhum22.seq 299003321
human23 177645 94436047 ddbjhum23.seq 299014983
human24 70719 113369003 ddbjhum24.seq 290480799
invertebrates1 12178 208003835 ddbjinv1.seq 299162120
invertebrates2 8936 180013392 ddbjinv2.seq 299001251
invertebrates3 91393 90208242 ddbjinv3.seq 299002682
invertebrates4 65359 106982770 ddbjinv4.seq 299003711
invertebrates5 54321 158543175 ddbjinv5.seq 299021647
invertebrates6 4030 40634861 ddbjinv6.seq 78704460
mammals 57857 78621055 ddbjmam.seq 212137278
patens1 255331 88976197 ddbjpat1.seq 299000128
patens2 218261 104989895 ddbjpat2.seq 299000587
patens3 166023 99470597 ddbjpat3.seq 299010842
patens4 130393 132462963 ddbjpat4.seq 299195714
patens5 159588 108005642 ddbjpat5.seq 299109644
patens6 154149 108814188 ddbjpat6.seq 299001786
patens7 177247 66909502 ddbjpat7.seq 299001117
patens8 125071 73823088 ddbjpat8.seq 299001654
patens9 135099 62499694 ddbjpat9.seq 299000195
patens10 120030 42754994 ddbjpat10.seq 179360304
phages 2458 11614985 ddbjphg.seq 29423339
plants1 25442 166259950 ddbjpln1.seq 299280249
plants2 40219 163267757 ddbjpln2.seq 299000734
plants3 89243 94050447 ddbjpln3.seq 299002134
plants4 65767 64600911 ddbjpln4.seq 299006723
plants5 24447 123268314 ddbjpln5.seq 299108257
plants6 1836 208810587 ddbjpln6.seq 299126303
plants7 59867 112390065 ddbjpln7.seq 299001424
plants8 73395 103072416 ddbjpln8.seq 299008810
plants9 20439 45542661 ddbjpln9.seq 113325792
primates 25447 165081839 ddbjpri.seq 262423891
rodents1 7618 206651191 ddbjrod1.seq 299100875
rodents2 1058 210201435 ddbjrod2.seq 299068632
rodents3 1177 215776183 ddbjrod3.seq 299028446
rodents4 1194 216681701 ddbjrod4.seq 299016364
rodents5 33840 168775661 ddbjrod5.seq 299071966
rodents6 1423 232071217 ddbjrod6.seq 299184825
rodents7 1470 231221134 ddbjrod7.seq 299072490
rodents8 25069 168674944 ddbjrod8.seq 299006595
rodents9 52444 129588642 ddbjrod9.seq 299004224
rodents10 9653 11509998 ddbjrod10.seq 35697406
STS1 104411 57884105 ddbjsts1.seq 299000817
STS2 105147 40669833 ddbjsts2.seq 299001341
STS3 53761 24027594 ddbjsts3.seq 144579928
synthetic DNAs 12056 18742788 ddbjsyn.seq 50444999
TPA 3952 13165310 ddbjtpa.seq 29126809
unannotated sequences 1341 603111 ddbjuna.seq 3239870
viruses1 86374 76922854 ddbjvrl1.seq 299001623
viruses2 87324 77261743 ddbjvrl2.seq 299001471
viruses3 46332 46224274 ddbjvrl3.seq 162750121
vertebrates1 72284 111528263 ddbjvrt1.seq 299259018
vertebrates2 37187 165655988 ddbjvrt2.seq 299002446
vertebrates3 6099 210806508 ddbjvrt3.seq 299017361
vertebrates4 26688 47874645 ddbjvrt4.seq 115012305
Accession number index file 0 0 ddbjacc.idx 1274465847
Gene name index file 0 0 ddbjgen.idx 58471149
Journal citation index file 0 0 ddbjjou.idx 1445186018
Keyword phrase index file 0 0 ddbjkey.idx 1169965682
-------------------------------------------------------
EST: expressed sequence tag
CON: Contig sequences
GSS: genome survey sequence
HTC: high throughput cDNA
HTG: high throughput genome sequence
STS: sequence tagged site
TPA: third party annotation
|
