DNA Data Bank of Japan

DDBJ release note (Rel. 57)

Search for
Site Map
about DDBJ
Data Submission
SAKURA
       Mass Sub
Data Updates
Search and Analysis
ARSA   getentry
TXSearch  
FASTA   BLAST
SSEARCH
  HMMPFAM
ClustalW
 
WebAPI
 
GIB
  GIB-V
GTPS
  GTOP
Breakdown Stats
Download data
  DDBJ Release Note
  Release Information
Q and A
Dorrs for Infomation Bioligy
  Conference on Info Bio

 Contact Us  
Copyright © 1995-2006
DDBJ All rights reserved.
                          DNA Data Bank of Japan

                              DNA Database

   Release 57, March 2004, including 32,693,678 entries, 38,008,449,840 bases

This database may be copied and redistributed without permission on the
condition that all the statements in this release note are reproduced in each
copy.

The present release contains the newest data prepared by the DNA Data Bank of
Japan (DDBJ), GenBank, and European Molecular Biology Laboratory/European
Bioinformatics Institute (EMBL/EBI) as of February 25, 2004.  This unified database
was made possible thanks to the international collaboration among the three
data banks.  All the entries have accordingly been annotated using the feature
keys common to them.

All the entries designated by the accession numbers with the prefixes "C",
"D", "E", "AB", "AG", "AK", "AP", "AT", "AU", "AV", "BA", "BB", "BD", "BJ",
"BP", "BS", "BW" and "BY" have been collected and processed by DDBJ, and the rest
have been prepared by GenBank and EMBL/EBI.

There have been a number of genome projects going on worldwide.  Among them
human genome projects have probably been most productive and yielded a large
number of ordinary sequences, huge amounts of ESTs and quantities of genome
sequences.  Thus, we have the human(HUM) division solely for human sequences
and the primate (PRI) division for non-human primate sequences.  The HUM
division in this release was recorded in 21 files each of which had 300 MB
storage capacity. Incidentally, the BCT, HTC, INV, PLN, ROD, STS, VRL and
VRT divisions were recorded in 7, 3, 6, 9, 10, 3, 3, 4 files, respectively.
Note that the EST division also contains human sequences.

The present release does not have the ORG division.  Thus, if you are interested
in human mitochondrial sequences, for example, you are now advised to refer to
the HUM division.

This release includes a division (PAT) for patent data.  The patent data
are those which the Japanese Patent Office (JPO), United States Patent and
Trademark Office (USPTO), and the European Patent Office (EPO) collected and
processed.  The accession numbers of the patent data collected by the Japanese
Patent Office start with the prefix "E" and "BD", those collected and supplied
by USPTO and GenBank respectively start with "I" and "AR", and those collected
and supplied by EPO and EMBL/EBI respectively start with "A" and "AX".  The
entries with the prefixes "I", "AR", "A", "AX", "E" and "BD" were allocated
to ten files (ddbjpat1.seq _ ddbjpat10.seq) in the DDBJ format.  Note also
that unauthorized use of the patent data may cause legal issues for which
we take no responsibility.

In the present release, the SOURCE in the flat file was revisited and revised
if necessary in accordance with the unified taxonomy database common to the
three data banks.

The number of ESTs has been increasing at an enormous rate and is expected
to be growing even more rapidly in the future.  Therefore, EST data were
stored in 223 files each of which had the same storage capacity as the file
of the HUM division.

The present release includes the GSS division.  GSS stands for the Genome
Survey Sequence, which is similar to EST, except that GSS is genomic DNA
whereas EST is cDNA.  This division was recorded in 80 files similarly to
the HUM division.

This release also includes the High Throughput Genomic Sequence (HTGS), which
comes mainly from genome project teams which deal with a clone as a sequencing
unit.  HTGS in this release were recorded in 52 files similarly to the HUM
division.

The index files are not presented in this release except for ddbjacc.idx,
ddbjgen.idx, ddbjjou.idx, and ddbjkey.idx.  Instead, we have included a program
by which to make the index files not presented in this release.  For the use of
the program, see the files, seq2indexes.doc, seq2indexes.c, and seq2indexes.h
in this release.

The present release contains amino acid sequences that were translated from
the corresponding nucleotide sequences in our database. In the translation
we paid much attention to the fact that some species or organella have a
codon different from the universal one, and used the proper codon table.  If
you find an incorrect codon in a translated sequence, please let us know.

The three data banks include the item VERSION in the flat file, which
indicates a version of a submitted nucleotide sequence (see Table 1).  It is
expressed like AB123456.1, in which the digit(s) after the period is a
version number.  The reason for adding VERSION is that since a released
sequence sometimes revised by the submitter, the accession number alone cannot
specify the sequence in question causing the user a trouble.  The number is
increased by one every time when a revised sequence is made public.
Accordingly, the translated protein sequence will be accompanied with a
/protein_id which is expressed as BAA12345.1, in which the digit(s) after the
period is again a version number.  The number is increased by one when the
corresponding nucleotide sequence is revised and the protein sequence is
changed as a result, and when the revised protein sequence is made public.

We terminated the RNA division.  The RNA data have been redistributed according
to the category of the organism.  Therefore, you will find a human RNA
sequence, for example, in the HUM division.

The present release includes a division, CON.  The CON division is to show the
order of related sequences in a genome, and expressed by join and the accession
numbers of the sequences.  The contents of the CON division are compiled by the
three data banks not by the data submitter.  The current number of the entries
of this division is 16190.  The entries and bases in the CON division are not
counted in the released numbers on the top of the release note.

The present release also includes, HTC (High Throughput cDNA).  This division
is to include unfinished high throughput cDNA sequences, each of which has
5'UTR and 3'UTR at both ends and part of a coding region.  The sequence may
also include introns.  When the sequence becomes finished later, it moves
to the corresponding taxonomic division.  The sequence is accompanied with
a keyword, HTC (High Throughput cDNA), which is dropped when the sequence
is finished and moved to a taxonomic division.

Since release 51, TPA (Third Party Annotation) data have been available.  The
entries and bases in TPA are not counted in the released numbers on the top of
the release note.

Since release 54, '/sequenced_mol' qualifier has been changed  to '/mol_type'
qualifier.  We accordingly completed retrofitting the pertinent entries.
This change was made on the agreement at the INSD international collaborative
meeting in 2002.
    /mol_type qualifier
        Definition:  in vivo molecule type
        Value format:  molecule type
        where molecule type is limited to followings;
        "genomic DNA", "genomic RNA", "mRNA" (incl. EST), "tRNA", "rRNA",
        "snoRNA", "snRNA", "scRNA", "pre-mRNA", "other RNA" (incl. synthetic),
        "other DNA" (incl. synthetic), "unassigned DNA" (incl. unknown),
        "unassigned RNA" (incl. unknown)

The BASE COUNT line of the DDBJ flat file format has been changed since DDBJ
release 56, corresponding to the relaxation of the maximum sequence length
restriction (350,000 bp/entry) in the entry that had been practised at
DDBJ/EMBL/GenBank International Nucleotide Sequence Databases.   In the BASE
COUNT line of the DDBJ flat file format, 6 digits had been allocated for each
number of a, c, g, t and other bases in the sequence. Hereafter, in the new
flat file format, 9 digits are allocated for each number of a, c, g and t,
while the numbers of other bases are removed.   In accordance with the
relaxation of sequence length limitation, GenBank had already dropped the BASE
COUNT line from their flat file format from GenBank Release 138 (Oct. 2003).
We DDBJ have decided to maintain the BASE COUNT line in our flat file format
from the view that GC contents are still important information to characterize
the sequence.
Prior to publication of release 56 in December, 2003, the new DDBJ flat file
format is adopted to daily data update from Dec. 3.
Following is an example of the new BASE COUNT line.
    1    6   11   16   21   26   31   36   41   46   51   56   61   66   71
    |----|----|----|----|----|----|----|----|----|----|----|----|----|----|
    BASE COUNT    123456789 a    123456789 c    123456789 g    123456789 t


This release is published by the following DDBJ staff.
T. Gojobori, Y. Tateno, K. Nishikawa, H. Sugawara, N. Saitou, K. Okubo,
S. Miyazaki,K. Ikeo, Y. Suzuki, S. Fukuchi, A. Kinjo, K. Itoh,
S. Adachi, H. Aono, M. Ejima, N. Endo, Y. Fujisawa, D. Fukuda, M. Gojobori,
A. Hashizume, T. Hirai, N. Hoshi, H. Ichikawa, K. Ichikawa, T. Iizuka,
N. Ishizaka, T. Kato, T. Kawamoto, J. Kohira, Ta. Koike, To. Koike, T. Konno,
T. Kosuge, A. Kusakabe, Y. Lin, K. Mamiya, N. Maruyama, J. Mashima, M. Matsuo,
K. Mimura, S. Misu, S. Miyazawa, N. Murakata, S. Nagira, M. Nagura,
N. Nishinomiya, T. Okido, K. Sakai, Y. Shigemoto, F. Sugiyama, M. Suzuki,
T. Takaki, H. Tsutsui, M. Tsuboi, K. Watanabe, M. Yamaguchi, Y. Yamamoto,
E. Yokoyama

Center for Information Biology and DNA Data Bank of Japan
National Institute of Genetics
Mishima 411-8540, Japan
Phone:  +81 55 981 6853
FAX:    +81 55 981 6849
E-mail: ddbj@ddbj.nig.ac.jp  (for general inquiry)
        ddbjsub@ddbj.nig.ac.jp  (for data submission)
        ddbjupdt@ddbj.nig.ac.jp (for updates and notification of publication)
WWW:    http://www.ddbj.nig.ac.jp/ (for DDBJ WWW server)
        http://sakura.ddbj.nig.ac.jp/
        (for DDBJ sequence data submission system)

Acknowledgement: We are grateful to NCBI and EMBL/EBI for a firm friendship
and an excellent collaboration with us.  We also thank the Japanese Patent
Office for a steady cooperation with us.  The operation of DDBJ is supported
by the Ministry of Education, Culture, Sports, Science and Technology, and we
would gratefully note this here.



DDBJ Database Release History

Release  Date     Entries     Bases          Comments
 57     03/04  32,693,678  38,008,449,840
 56     12/03  30,405,173  36,079,046,032
 55     09/03  27,753,140  34,280,225,489
 54     06/03  25,149,821  32,162,041,177
 53     02/03  23,250,813  29,711,299,332
 52     12/02  20,354,812  26,931,456,316
 51     09/02  18,401,358  22,782,404,136   TPA started
 50     06/02  17,260,693  20,158,357,982
 49     04/02  16,503,157  18,579,627,226
 48     01/02  15,016,100  16,197,713,855
 47     10/01  13,266,610  14,145,671,645
 46     07/01  12,313,759  13,037,646,166
 45     04/01  11,434,113  12,207,092,905   HTC division started
 44     01/01  10,165,597  11,136,298,841
 43     10/00   8,666,551  10,034,532,698
 42     07/00   7,554,995   8,880,721,093
 41     04/00   5,962,608   6,409,581,885   CON division started
 40     01/00   5,388,125   4,762,696,173   RNA division terminated
 39     10/99   4,810,773   3,728,000,562   NID and PID discarded
 38     07/99   4,294,369   3,098,519,597
 37     03/99   3,311,627   2,375,261,951   VERSION, /protein_id started
 36     01/99   3,073,166   2,190,425,560
 35     10/98   2,759,261   1,957,341,169
 34     07/98   2,412,785   1,708,580,623
 33     04/98   2,174,769   1,479,303,279
 32     01/98   1,956,669   1,300,950,613
 31     10/97   1,731,532   1,139,869,464   Adoption of the unified taxonomy
                                            database
 30     07/97   1,534,115     992,788,339   NID and PID terminated
 29     04/97   1,270,194     841,415,232
 28     01/97   1,154,120     756,785,219   HTG division started
                                            ORG division terminated
 27     10/96     936,697     608,103,057   GSS division started
 26     07/96     835,552     551,932,448
 25     04/96     744,490     499,300,364   /translation started
 24     01/96     637,508     431,771,652
 23     10/95     569,757     390,694,350
 22     07/95     437,588     322,982,425   HUM division started
 21     04/95     274,596     250,875,023
 20     01/95     239,689     231,299,557
 19     10/94     204,332     205,274,131
 18     07/94     185,230     192,473,021
 17     04/94     169,957     179,942,209
 16     01/94     154,626     165,017,628
 15     10/93     131,649     147,224,690
 14     07/93     120,350     138,686,333
 13     04/93     112,067     129,784,445
 12     01/93      97,683     120,815,244   EST division started
 11     07/92      65,693      84,839,075
 10     01/92      59,317      77,805,556   GenBank/EMBL inclusion started
  9     07/91       1,130       2,002,124
  8     01/91         879       1,573,442
  7     07/90         681       1,154,211
  6     01/90         496         841,236
  5     07/89         395         679,378
  4     01/89         302         535,985
  3     07/88         230         345,850
  2     01/88         142         199,392
  1     07/87          66         108,970   Started with DDBJ only
------------------------------------------------------------------------




This release covers 20 categories of organisms and others as follows:
------------------------------------------------------------------------------
ddbjbct.*** Category for bacteria
ddbjest.*** Category for EST (expressed sequence tag)
ddbjcon.*** Category for CON (Contig sequences)
ddbjhtc.*** Category for HTC (high throughput cDNA)
ddbjhtg.*** Category for HTG (high throughput genomic sequence)
ddbjhum.*** Category for human
ddbjgss.*** Category for GSS (Genome Survey Sequence)
ddbjinv.*** Category for invertebrates
ddbjmam.*** Category for mammals other than primates and rodents
ddbjpat.*** Category for patents
ddbjphg.*** Category for phages
ddbjpln.*** Category for plants
ddbjpri.*** Category for primates other than human
ddbjrod.*** Category for rodents
ddbjsts.*** Category for STS (sequence tagged site)
ddbjsyn.*** Category for synthetic DNAs
ddbjtpa.*** Category for TPA (Third Party Annotation)
ddbjuna.*** Category for unannotated sequences
ddbjvrl.*** Category for viruses
ddbjvrt.*** Category for vertebrates other than mammals
------------------------------------------------------------------------------



Each category then has the following nine files. Note that all the files
except for ddbj***.seq are created by the user by use of seq2indexes as
mentioned in the release note.
------------------------------------------------------------------------------
ddbj***.seq  List of an entry in DDBJ format, see Table 1.
ddbj***.acc  List of the accession numbers, see Table 2 .
ddbj***.aut  List of the authors, see Table 3.
ddbj***.dir  List of the short directory in DDBJ style, see Table 4.
ddbj***.idx  List of indices, see Table 5.
ddbj***.jou  List of the journals, see Table 6.
ddbj***.key  List of the key words, see Table 7.
ddbj***.org  List of the species names, see Table 8.
ddbj***.sdr  List of the short directory in DDBJ style, see Table 9.
------------------------------------------------------------------------------



The format of LOCUS line in the flat file was changed as shown below
to adjust to the GenBank format from release 51.
------------------------------------------------------------------------------
Old (-rel. 50):
LOCUS       AB000001      660 bp    DNA             PLN       01-FEB-2001
Present (rel. 51-):
LOCUS       AB000001                 660 bp    DNA     linear   PLN 01-FEB-2001

New format specification:
---------  --------
Positions  Contents
---------  --------
01-05   'LOCUS'
06-12   spaces
13-28   Locus name
29-29   space
30-40   Length of sequence, right-justified
41-41   space
42-43   bp
44-44   space
45-47   spaces, ss- (single-stranded), ds- (double-stranded), or
         ms- (mixed-stranded)
48-53   DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), mRNA
        (messenger RNA), uRNA (small nuclear RNA), scRNA, snRNA, snoRNA.
        Left justified.
54-55   space
56-63   'linear' followed by two spaces, or 'circular'
64-64   space
65-67   The division code
68-68   space
69-79   Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
------------------------------------------------------------------------------



Table 1. Part of the contents in the file 'ddbjbct.seq'.
This shows all pieces of information on one entry in DDBJ format.
------------------------------------------------------------------------------
LOCUS       D87069                   993 bp    mRNA    linear   BCT 14-APR-2000
DEFINITION  Escherichia coli mRNA for RNA polymerase sigma subunit, truncated
            form of sigma-38, complete cds.
ACCESSION   D87069
VERSION     D87069.1
KEYWORDS    RNA polymerase sigma subunit, truncated form of sigma-38.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;
            Escherichia.
REFERENCE   1  (bases 1 to 993)
  AUTHORS   Jishage,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-AUG-1996) to the DDBJ/EMBL/GenBank databases. Miki
            Jishage, National Institute of Genetics, Molecular Genetics; Yata
            1111, Mishima, Shizuoka 411, Japan (E-mail:mjishage@lab.nig.ac.jp,
            Tel:0559-81-6742, Fax:0559-81-6746)
REFERENCE   2  (bases 1 to 993)
  AUTHORS   Jishage,M. and Ishihama,A.
  TITLE     Variation in RNA polymerase sigma subunit composition within
            different stocks of Escherichia coli starin W3110
  JOURNAL   Unpublished (1996)
REFERENCE   3
  AUTHORS   Ivanova,A., Renshaw,M., Guntaka,R. and Eisenstark,A.
  TITLE     DNA base sequence variability in katF (putative sigma factor) gene
            Escherichia coli
  JOURNAL   Nucleic Acids Res. 20, 5479-5480 (1992)
REFERENCE   4
  AUTHORS   Takayanagi,Y., Tanaka,K. and Takahashi,H.
  TITLE     Structure of the 5' upstream region and the regulation of the rpoS
            gene of Escherichia coli
  JOURNAL   Mol. Gen. Genet. 243, 525-531 (1994)
COMMENT
FEATURES             Location/Qualifiers
     source          1..993
                     /mol_type="mRNA"
                     /organism="Escherichia coli"
                     /strain="W3110"
     CDS             1..810
                     /note="the gene has four single base changes, resulting
                     in two amino acid substitutions and an amber mutation"
                     /product="RNA polymerase sigma subunit, truncated form of
                     sigma-38"
                     /protein_id="BAA13238.1"
                     /transl_table=11
                     /translation="MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEYEPSDNDLAEEE
                     LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV
                     VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN
                     QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER
                     ITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAK"
     variation       75
                     /citation=[3]
                     /replace="t"
     variation       97
                     /citation=[3]
                     /replace="t"
     variation       99
                     /citation=[3]
                     /replace="t"
     variation       808
                     /citation=[3]
                     /replace="t"
BASE COUNT          254 a          223 c          291 g          225 t
ORIGIN
        1 atgagtcaga atacgctgaa agttcatgat ttaaatgaag atgcggaatt tgatgagaac
       61 ggagttgagg tttttgacga aaaggcctta gtagaatatg aacccagtga taacgatttg
      121 gccgaagagg aactgttatc gcagggagcc acacagcgtg tgttggacgc gactcagctt
      181 taccttggtg agattggtta ttcaccactg ttaacggccg aagaagaagt ttattttgcg
      241 cgtcgcgcac tgcgtggaga tgtcgcctct cgccgccgga tgatcgagag taacttgcgt
      301 ctggtggtaa aaattgcccg ccgttatggc aatcgtggtc tggcgttgct ggaccttatc
      361 gaagagggca acctggggct gatccgcgcg gtagagaagt ttgacccgga acgtggtttc
      421 cgcttctcaa catacgcaac ctggtggatt cgccagacga ttgaacgggc gattatgaac
      481 caaacccgta ctattcgttt gccgattcac atcgtaaagg agctgaacgt ttacctgcga
      541 accgcacgtg agttgtccca taagctggac catgaaccaa gtgcggaaga gatcgcagag
      601 caactggata agccagttga tgacgtcagc cgtatgcttc gtcttaacga gcgcattacc
      661 tcggtagaca ccccgctggg tggtgattcc gaaaaagcgt tgctggacat cctggccgat
      721 gaaaaagaga acggtccgga agataccacg caagatgacg atatgaagca gagcatcgtc
      781 aaatggctgt tcgagctgaa cgccaaatag cgtgaagtgc tggcacgtcg attcggtttg
      841 ctggggtacg aagcggcaac actggaagat gtaggtcgtg aaattggcct cacccgtgaa
      901 cgtgttcgcc agattcaggt tgaaggcctg cgccgtttgc gcgaaatcct gcaaacgcag
      961 gggctgaata tcgaagcgct gttccgcgag taa
//
------------------------------------------------------------------------------


Table 2. Part of the contents in the file 'ddbjbct.acc'.
The first column refers to the secondary accession number, second column to
the locus name, and third to the primary accession number. The primary number
may be the same as the secondary number. They are arranged in the ascending
order of the secondary accession numbers.
------------------------------------------------------------------------------
D00001 -> ECOPBPAA   X04516
D00002 -> ECOPYRH    X04469
D00006 -> PNS981TET  D00006
D00020 -> COLE2LYS   D00020
D00021 -> COLE31YS   D00021
D00038 -> BRLAM330   D00038
D00066 -> BAC139AC   D00066
D00067 -> ECONANA    M20207
D00069 -> ECOUVRD2   D00069
D00087 -> BACXYNAA   D00087
------------------------------------------------------------------------------


Table 3. Part of the contents in the file 'ddbjbct.aut'.
For each author name given on the left to the arrow, the corresponding locus
name and primary accession number are respectively listed on the right. They
are arranged in the alphabetical order of the author names.
------------------------------------------------------------------------------
Aan,F. -> STYCRR     X05210
Aan,F. -> STYENZI    M76176
Aaronson,W. -> ECOKPSD    M64977
Aaronson,W. -> ECONEUA    J05023
Abad-Lapuebla,M.A. -> VIBTDHI    D90238
Abdel-Mawgood,A.L. -> CYAPSBHA   X16394
Abdel-Meguid,S.S. -> TRNGDRECM  J01843
Abdelal,A. -> STYCARA    M36540
Abdelal,A. -> STYCARAB   X13200
Abdelal,A.H. -> PSENOSA    M60717
------------------------------------------------------------------------------


Table 4. Part of the short directory in DDBJ style in the file 'ddbjbct.dir'.
For each locus name given in the first column, the corresponding primary
accession number, molecular type, number of nucleotide pairs, and description
for the locus are respectively listed. They are arranged in the alphabetical
order of the locus names.
------------------------------------------------------------------------------
ABCAARAA   M34830 ds-DNA    1624 A.aceti acetic acid resistance protein (aarA)
gene, complete cds.
ABCADHCC   D00635 ds-DNA    4230 A. polyoxogenes alcohol dehydrogenase (EC
1.1.99.8) and cytochrome c genes.
ABCALDH    D00521 ds-DNA    2683 A.polyoxogenes membrane-bound aldehyde
dehydrogenase gene, complete cds and flanks.
ABCBCSAA   M37202 ds-DNA    9540 A.xylinum bcs B, bcs C and bcs D genes,
complete cds and bcs A gene, partial cds.
ABCCELA    M76548 ds-DNA    1165 Acetobacter xylinum UDP pyrophosphorylase
(celA) gene, complete cds.
ABCCELSYN  X54676 ds-DNA    5363 A. xylinum gene for cellulose biosynthesis
ABCIS1380  D10043 ds-DNA    1665 A.pasteurianus insertion sequence IS1380.
ACAADH1    D90004 ds-DNA    2467 Acetobacter aceti(K6033) alcohol dehydrogenase
subunit gene(adh1).
ACCAAC2    M62833 ds-DNA    1123 Acinetobacter baumannii aminoglycoside
acetyltr ansferase (aac2) gene, complete cds.
ACCACEAA   M62822 ds-DNA    1874 A.baumannii chloramphenicol acetyltransferase
(cat) gene, complete cds.
------------------------------------------------------------------------------


Table 5. Part of the contents in the file 'ddbjbct.idx'.
The first column refers to the locus name, second column to the starting site
of the locus in byte, and third to its ending site in byte. They are arranged
in the alphabetical order of the locus names.
------------------------------------------------------------------------------
%*****************************
#ABCAARAA       0       3211
#ABCADHCC       3212    10608
#ABCALDH        10609   15864
#ABCBCSAA       15865   29583
#ABCCELA        29584   32289
#ABCCELSYN      32290   40960
#ABCIS1380      40961   44711
#ACAADH1        44712   49357
#ACCAAC2        49358   52395
------------------------------------------------------------------------------


Table 6. Part of the contents in the file 'ddbjbct.jou'.
This gives information on the journal in which sequence data were published.
------------------------------------------------------------------------------
(in) Chaloupka,J. and Krumphanzl,V. (Eds.); Extracellular Enzymes of
Microorganisms:  129-137, Plenum Press, New York (1987) -> BACAMYABS  M57457
(in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene
Regulation in Bacilli:  3-10, Academic Press, New York (1982) -> BACRG16S
M55011
(in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene
Regulation in Bacilli:  3-10, Academic Press, New York (1982) -> BACRG16SA
M55006
(in) Ganesan,A.T., Chang,S. and Hoch,J.A. (Eds.); Molecular Cloning and Gene
Regulation in Bacilli:  3-10, Academic Press, New York (1982) -> BACRG16SB
M55008
(in) Hoch,J.A. and Setlow,P. (Eds.); Molecular Biology of Microbial
Differentiation:  85-94, American Society for Microbiology, Washington, DC
(1985) -> BACSPOII   M57606
(in) Holmgren,A. (Ed.); Thioredoxin and Glutaredoxin Systems: Structure and
Function: 11-19, Unknown name, Unknown city (1986) -> ECOTRXA1   M54881
(in) Kjeldgaard,N.C. and Maaloe,O. (Eds.); Control of ribosome synthesis:
138-143, Academic Press, New York (1976) -> ECOLAC     J01636
(in) Losick,R. and Chamberlin,M. (Eds.); RNA polymerase:  455-472, Cold
Spring Harbor Laboratory, Cold Spring Harbor, NY (1976) -> ECOTGY1    K01197
(in) Sikes,C.S. and Wheeler,A.P. (Eds.); Surface reactive peptides and
polymers. Discovery and commercialization.:  186-200, American Chemical
Society, Washington, D.C. (1991) -> ECOTGP     J01714
(in) Sund,H. and Blauer,G. (Eds.); Protein-Ligand Interactions:  193-207,
Walter de Gruyter, New York (1975) -> ECOLAC     J01636
(in) Wu,R. and Grossman,L. (Eds.); Methods in Enzymology, Recombinant DNA,
part E:  In press, Academic Press, New York, N.Y. (1986) -> PLMCG      M11320
Acta Microbiol. Pol. 35, 175-190 (1986) -> ECOTGG1    M54893
Actinomycetologica 5, 14-17 (1991) -> STMARGG    D00799
Adv. Biophys. 21, 115-133 (1986) -> R10REP     M26840
Adv. Biophys. 21, 175-192 (1986) -> ECONUSAA   M26839
Adv. Enzyme Regul. 21, 225-237 (1983) -> ECOPURFA   M26893
Adv. Exp. Med. Biol. 195, 239-246 (1986) -> ECOAPT     M14040
Agric. Biol. Chem. 50, 2155-2158 (1986) -> ECONANA    M20207
Agric. Biol. Chem. 50, 2771-2778 (1986) -> BRLAM330   D00038
Agric. Biol. Chem. 51, 2019-2022 (1987) -> BACCGT     D00129
Agric. Biol. Chem. 51, 2641-2648 (1987) -> STRSAGP    D00219
Agric. Biol. Chem. 51, 2807-2809 (1987) -> BACPGECR   M35503
Agric. Biol. Chem. 51, 3133-3135 (1987) -> BACXYLAP   D00312
Agric. Biol. Chem. 51, 455-463 (1987) -> BACHDCRY   D00117
Agric. Biol. Chem. 51, 953-955 (1987) -> BACXYNAA   D00087
Agric. Biol. Chem. 52, 1565-1573 (1988) -> BACIP135   D00348
Agric. Biol. Chem. 52, 1785-1789 (1988) -> BACTMR     D00343
Agric. Biol. Chem. 52, 2243-2246 (1988) -> PSEGI      D00342
Agric. Biol. Chem. 52, 399-406 (1988) -> BACAMYEB   M35517
Agric. Biol. Chem. 52, 479-487 (1988) -> ECAPALI    D00217
------------------------------------------------------------------------------


Table 7. Part of the contents in the file 'ddbjbct.key'.
For the locus and accession number respectively given on the right to the
arrow, the corresponding key words are listed on the left.
------------------------------------------------------------------------------
A.aceti acetic acid resistance protein (aarA) gene, complete cds.       -> ABCAARAA
M34830
acetic acid resistance protein.         -> ABCAARAA     M34830
Cloning of genes responsible for acetic acid resistance in acetobacter aceti
-> ABCAARAA      M34830
A. polyoxogenes alcohol dehydrogenase (EC 1.1.99.8) and cytochrome c genes.
-> ABCADHCC      D00635
alcohol dehydrogenase; cytochrome c.    -> ABCADHCC     D00635
Cloning and sequencing of the gene cluster encoding two subunits of membrane-
bound alcohol dehydrogenase from Acetobacter polyoxogenes  -> ABCADHCC
D00635
These data kindly submitted in computer readable form by: Toshimi Tamaki
Nakano Central Biochemical Institute 2-6 Nakamura-cho Handa-shi, Aichi-ken
475 Japan Phone: 0569-21-3331 Fax: 0569-23-8486     -> ABCADHCC     D00635
A.polyoxogenes membrane-bound aldehyde dehydrogenase gene, complete cds and
flanks.     -> ABCALDH      D00521
aldehyde dehydrogenase gene; ethanol oxidation; membrane-bound enzyme.  -> ABCALDH
D00521
Nucleotide sequence of the membrane-bound aldehyde dehydrogenase gene from
Acetobacter polyoxogenes     -> ABCALDH      D00521
------------------------------------------------------------------------------


Table 8. Part of the contents in the file 'ddbjbct.org'.
For the locus and accession number respectively given on the right to the
arrow, the corresponding taxonomic names are listed on the left.  They are
arranged in the alphabetical order of the species names.
------------------------------------------------------------------------------
A. nidulans 6301 DNA. Anacystis nidulans Prokaryota; Bacteria; Gracilicutes;
Oxyphotobacteria; Cyanobacteria.   -> ANIRUBPS     X00019
A. nidulans DNA, clone pAN4. Anacystis nidulans Prokaryota; Bacteria;
Gracilicutes; Oxyphotobacteria; Cyanobacteria.    -> ANIRGGX      X00343
A. nidulans DNA. Anacystis nidulans Prokaryota; Bacteria; Gracilicutes;
Oxyphotobacteria; Cyanobacteria.        -> ANIRGG       X00512
A. polyoxogenes genomic DNA. Acetobacter polyoxogenes Prokaryota; Bacteria;
Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae.      -
> ABCADHCC     D00635
A. quadruplicatum (strain PR-6) DNA, clone pAQPR1. Agmenellum quadruplicatum
Prokaryota; Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria.       -> AQUPCAB
K02660
A. quadruplicatum (strain PR6) DNA. Agmenellum quadruplicatum Prokaryota;
Bacteria; Gracilicutes; Oxyphotobacteria; Cyanobacteria.      -> AQUCPCAB
K02659
A. vinelandii DNA. Azotobacter vinelandii Prokaryota; Bacteria; Gracilicutes;
Scotobacteria; Aerobic rods and cocci; Azotobacteraceae.  -> AVINIFUSV
M17349
A.aceti (strain 10-8) DNA, clone pAR1611. Acetobacter aceti Prokaryota;
Bacteria; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.       -> ABCAARAA      M34830
A.actinomycetemcomitans (strain JP2) DNA, clone lambda-OP8. Actinobacillus
actinomycetemcomitans Prokaryota; Bacteria; Gracilicutes; Scotobacteria;
Facultatively anaerobic rods; Pasteurellaceae.      -> ACNLKTXN     M27399
A.anitratum DNA, clone pLJD1. Acinetobacter anitratum Prokaryota; Bacteria;
Gracilicutes; Scotobacteria; Neisseriaceae.         -> ACCCITSYN    M33037
------------------------------------------------------------------------------


Table 9. Part of the short directory file in DDBJ style in the file
'ddbjbct.sdr'.
The short directory file contains brief descriptions of all of the sequence
entries contained in the DDBJ style.
------------------------------------------------------------------------------
ABCAARAA    A.aceti acetic acid resistance protein (aarA) gene, complete 1624bp
ABCADHCC    A. polyoxogenes alcohol dehydrogenase (EC 1.1.99.8) and      4230bp
ABCALDH     A.polyoxogenes membrane-bound aldehyde dehydrogenase gene,   2683bp
ABCBCSABCD  A.xylinum bcs A, B, C and D genes, complete cds's.           9540bp
ABCCELA     Acetobacter xylinum UDP pyrophosphorylase (celA) gene,       1165bp
ABCCELSYN   A. xylinum gene for cellulose biosynthesis                   5363bp
ABCIS1380   A.pasteurianus insertion sequence IS1380.                    1665bp
ACAADH1     Acetobacter aceti(K6033) alcohol dehydrogenase subunit       2467bp
ACCAAC2     Acinetobacter baumannii aminoglycoside acetyltransferase     1123bp
ACCACEAA    A.baumannii chloramphenicol acetyltransferase (cat) gene,    1874bp
ACCAPHA6    Acinetobacter baumannii aphA-6 gene.                         1170bp
ACCBENABCA  A.calcoaceticus BenA, BenB, BenC, BenD, and BenE proteins   15922bp
ACCCAT      Acinetobacter calcoaceticus cat operon.                     15922bp
ACCCATAM    A.calcoaceticus catA and catM genes, encoding catechol 1,    5537bp
ACCCHMO     Acinetobacter sp. cyclohexanone monooxygenase gene, complete 2128bp
ACCCITSYN   A.anitratum citrate synthase gene, complete cds.             1895bp
------------------------------------------------------------------------------



In addition to the 9 tables the four following index files are included in
this release. These files were prepared irrespective of the 10 categories of
taxonomic divisions.

 Accession number index file
 Keyword phrase index file
 Journal citation index file
 Gene name index file

A brief description is given for each file in the following.


Table 10. Part of the accession number index file in the 'ddbjacc.idx'.
The following excerpt from the accession number index file illustrates the
format of the index.
------------------------------------------------------------------------------
D00100    PSEASPAA   BCT D00100
D00101    RABNP450R  MAM D00101
D00102    HUMLTX     HUM D00102
D00103    AFARRN5SA  BCT D00103   AFRRN5SA   BCT X05517
D00104    AFARRN5SB  BCT D00104   AFRRN5SB   BCT X05518
D00105    AFARRN5S   BCT D00105   ASRRN5S    BCT X05524
D00106    ACH5SRR    BCT D00106   AXRRN5S    BCT X05522   AXRRN5SA   BCT X05523
D00107    ACH5SRRX   BCT D00107   ACRRN5S    BCT X05521
------------------------------------------------------------------------------


Table 11. Part of the keyword phrase index file in the 'ddbjkey.idx'.
Keyword phrases consist of names for gene products and other characteristics
of sequence entries.
------------------------------------------------------------------------------
A CHANNEL
             DROCHA     INV M17155
A COMPONENT
             SQLCVEA    VRL M38183
A LOCUS
             GORGOGOA3  PRI X54375 GORGOGOA4  PRI X54376
A LOCUS ALLELE
             GORA0101   PRI X60258 GORA0201   PRI X60259 GORA0401   PRI X60257
             GORA0501   PRI X60256
A MULTI-GENE FAMILY
             RICGLUTE   PLN D00584
A PROTEIN
             MS2AAR     PHG M25187 ST1APCS    PHG M25396
A SEQUENCE
             HS5TOA30   VRL D00148 HS5TOA31   VRL D00147
------------------------------------------------------------------------------


Table 12. Part of the journal citation index file in 'ddbjjou.idx'.
The journal citation index file lists all of the citations that appear in the
references.
------------------------------------------------------------------------------
ACTA BIOCHIM. BIOPHYS. SIN. 23, 246-253 (1992)
             HUMPLASINS HUM M98056
ACTA BIOCHIM. BIOPHYS. SIN. 28, 233-239(1996)
             TKTII     PLN X82230
ACTA BIOCHIM. POL. 24, 301-318 (1977)
             LUPTRFJ   PLN K00345    LUPTRFN   PLN K00346
ACTA BIOCHIM. POL. 26, 369-381(1979)
             HVTRNPHE  PLN X02683
ACTA BIOCHIM. POL. 29, 143-149 (1982)
             EMEMTA    PLN M32572    EMEMTB    PLN M32573    EMEMTC    PLN M32574
             EMEMTD    PLN M32575    EMEMTE    PLN M32576
ACTA BIOCHIM. POL. 34, 21-27 (1987)
             LUPNOSP    PLN M32571
------------------------------------------------------------------------------


Table 13. Part of the gene name index file in 'ddbjgen.idx'.
This file lists all the gene names that appear in the feature table.
------------------------------------------------------------------------------
AACC8
             STMAACC8   BCT M55426
AACC9
             MPUAACC9   BCT M55427
AACT
             HUMA1ACM   PRI K01500 HUMA1ACMA  PRI X00947 HUMA1ACMB  PRI M18035
             HUMAACT1   PRI M18906 HUMAACT2   PRI M22533 HUMAACTA   PRI J05176
AAD
             INTINTORF  BCT L06418 LMOMO229D  BCT X17478
AAD A1
             ENTAAC3VI  BCT M88012
AAD9
             ENEAAD9A   BCT M69221
AADA
             LMOMO229A  BCT X17479 S52249     BCT S52249 SYNAADA    SYN M60473
             TRNTAAB    BCT M55547 TRNTN21CAS BCT M86913
------------------------------------------------------------------------------


The files in this release are arranged in the following order with
non-labeled format.

Category                      number of  number of   file name      file size
                             entries    bases
Release note                                      ddbjrel.txt            72421
bacteria1                     28325   120321805   ddbjbct1.seq       299041039
bacteria2                      6877   130913011   ddbjbct2.seq       299625645
bacteria3                     48591   116187543   ddbjbct3.seq       299002020
bacteria4                     53564   108026785   ddbjbct4.seq       299146839
bacteria5                     26732   130949801   ddbjbct5.seq       299001618
bacteria6                     40062   118220823   ddbjbct6.seq       299034729
bacteria7                     36927    73278934   ddbjbct7.seq       195030845
CON                           16190           0   ddbjcon.seq         64476558
EST1                          90092    33919201   ddbjest1.seq       299000961
EST2                          94909    38175564   ddbjest2.seq       299002718
EST3                          95456    37053779   ddbjest3.seq       299000508
EST4                          89429    28106820   ddbjest4.seq       299000560
EST5                          94290    36413936   ddbjest5.seq       299001554
EST6                          98428    39008125   ddbjest6.seq       298999953
EST7                          98537    38046950   ddbjest7.seq       299002561
EST8                          97457    37753782   ddbjest8.seq       299002153
EST9                          98174    38758905   ddbjest9.seq       299002652
EST10                         99189    38789629   ddbjest10.seq      299003488
EST11                         97700    39026354   ddbjest11.seq      299000423
EST12                         96811    43308671   ddbjest12.seq      299001170
EST13                        105349    42364734   ddbjest13.seq      299001283
EST14                        101826    41099262   ddbjest14.seq      299003242
EST15                         97670    40980111   ddbjest15.seq      299001534
EST16                         94481    42210153   ddbjest16.seq      299002230
EST17                         96914    39088603   ddbjest17.seq      299000147
EST18                         97882    42658046   ddbjest18.seq      299004040
EST19                         96155    41859521   ddbjest19.seq      299002408
EST20                         95217    38999913   ddbjest20.seq      299000808
EST21                        108545    52137587   ddbjest21.seq      299000013
EST22                        111728    48896188   ddbjest22.seq      299001992
EST23                         87286    85526985   ddbjest23.seq      299001653
EST24                        116794    65583557   ddbjest24.seq      299000215
EST25                        121475    61839046   ddbjest25.seq      299001244
EST26                        130980    57080290   ddbjest26.seq      299000985
EST27                        118494    64902719   ddbjest27.seq      299000389
EST28                        108972    40758262   ddbjest28.seq      299000618
EST29                         92298    24565620   ddbjest29.seq      299002638
EST30                         90996    26764564   ddbjest30.seq      299002389
EST31                         60443    16481599   ddbjest31.seq      299004105
EST32                         60484    16640500   ddbjest32.seq      299004346
EST33                         87296    32643401   ddbjest33.seq      299001423
EST34                        120643    55014293   ddbjest34.seq      299001735
EST35                        108061    55947754   ddbjest35.seq      299002540
EST36                        107101    51689093   ddbjest36.seq      299000708
EST37                        130072    67170348   ddbjest37.seq      299000018
EST38                         95710    41510347   ddbjest38.seq      299002088
EST39                         90014    39411004   ddbjest39.seq      299003370
EST40                         92153    39779173   ddbjest40.seq      299003249
EST41                        100668    40521609   ddbjest41.seq      299001954
EST42                         94983    37475239   ddbjest42.seq      299004742
EST43                         82657    36839963   ddbjest43.seq      299002996
EST44                         95238    42242180   ddbjest44.seq      299001038
EST45                         97731    44051113   ddbjest45.seq      299002078
EST46                         96534    35230455   ddbjest46.seq      299002153
EST47                        108718    48050677   ddbjest47.seq      299000562
EST48                         65614    19861170   ddbjest48.seq      299002217
EST49                         60263    17458591   ddbjest49.seq      299000774
EST50                         60358    18578773   ddbjest50.seq      299002435
EST51                         60336    18871594   ddbjest51.seq      299000531
EST52                         60377    18879591   ddbjest52.seq      299003091
EST53                         60316    18056516   ddbjest53.seq      299002079
EST54                         60922    18612781   ddbjest54.seq      299004405
EST55                         61716    18733046   ddbjest55.seq      299002618
EST56                         61578    19477313   ddbjest56.seq      299002320
EST57                         62322    17535094   ddbjest57.seq      299003395
EST58                         58200    34288170   ddbjest58.seq      299002263
EST59                         55021    25365800   ddbjest59.seq      299000006
EST60                         54706    23956145   ddbjest60.seq      299000685
EST61                         54641    22696502   ddbjest61.seq      299000457
EST62                         60969    24714667   ddbjest62.seq      299000471
EST63                         93636    39647263   ddbjest63.seq      299001130
EST64                         95830    38725336   ddbjest64.seq      299001947
EST65                         97181    54946005   ddbjest65.seq      299001214
EST66                         99128    52971185   ddbjest66.seq      299002350
EST67                         98017    47328413   ddbjest67.seq      299000136
EST68                         94230    52748330   ddbjest68.seq      299002902
EST69                         94746    45311468   ddbjest69.seq      299000533
EST70                         95720    56281946   ddbjest70.seq      299000270
EST71                         93706    47761334   ddbjest71.seq      299001265
EST72                         89337    52662612   ddbjest72.seq      299000460
EST73                         90439    44617577   ddbjest73.seq      299001932
EST74                         95293    57872912   ddbjest74.seq      299001077
EST75                         89972    54054638   ddbjest75.seq      299003087
EST76                         94878    54224552   ddbjest76.seq      299001860
EST77                         91523    38695020   ddbjest77.seq      299001831
EST78                         85215    45538682   ddbjest78.seq      299002426
EST79                         83780    45644590   ddbjest79.seq      299000190
EST80                         92444    57193284   ddbjest80.seq      299000141
EST81                         97200    42632063   ddbjest81.seq      299000917
EST82                         95833    34453585   ddbjest82.seq      299002352
EST83                         95148    42725413   ddbjest83.seq      299002201
EST84                         85325    43976514   ddbjest84.seq      299002269
EST85                        102518    62027104   ddbjest85.seq      299000662
EST86                         98047    59443458   ddbjest86.seq      299003085
EST87                         87842    52266091   ddbjest87.seq      299000673
EST88                         93152    62969736   ddbjest88.seq      299000873
EST89                         89678    56093750   ddbjest89.seq      299000964
EST90                         95649    54016870   ddbjest90.seq      299001509
EST91                         94353    63697734   ddbjest91.seq      299000758
EST92                         93871    62843647   ddbjest92.seq      299003468
EST93                        100080    53269195   ddbjest93.seq      299000987
EST94                         97365    36621768   ddbjest94.seq      299000366
EST95                        103828    61246546   ddbjest95.seq      299000299
EST96                         96246    57340973   ddbjest96.seq      299002836
EST97                         84241    41285454   ddbjest97.seq      299000853
EST98                         88290    48500773   ddbjest98.seq      299001687
EST99                         84978    46677839   ddbjest99.seq      299001900
EST100                        91763    55415253   ddbjest100.seq     299001568
EST101                        91825    57120185   ddbjest101.seq     299002211
EST102                        86067    49788005   ddbjest102.seq     299002204
EST103                        95777    55925109   ddbjest103.seq     299000794
EST104                        79560    48284779   ddbjest104.seq     299003136
EST105                       108344    58717871   ddbjest105.seq     299001502
EST106                       105235    59716763   ddbjest106.seq     299003859
EST107                       109040    56758571   ddbjest107.seq     299001370
EST108                       130693    69679809   ddbjest108.seq     299000393
EST109                       119963    66954898   ddbjest109.seq     299001228
EST110                        95763    56801800   ddbjest110.seq     299001295
EST111                        90316    52389728   ddbjest111.seq     299002702
EST112                        85278    39545231   ddbjest112.seq     299000242
EST113                        72616    33825914   ddbjest113.seq     299004457
EST114                        82479    40362278   ddbjest114.seq     299002001
EST115                        73268    38083970   ddbjest115.seq     299001688
EST116                       100053    66782871   ddbjest116.seq     299003131
EST117                        85674    55981720   ddbjest117.seq     299000235
EST118                        95101    54701853   ddbjest118.seq     299001011
EST119                        79569    39442715   ddbjest119.seq     299000909
EST120                        84270    49539744   ddbjest120.seq     299001501
EST121                        83011    54261221   ddbjest121.seq     299002409
EST122                        91145    50968092   ddbjest122.seq     299001367
EST123                       103359    59441714   ddbjest123.seq     299001081
EST124                        91157    51126337   ddbjest124.seq     299001779
EST125                        86898    56044390   ddbjest125.seq     299003105
EST126                        76524    44446511   ddbjest126.seq     299001917
EST127                        88782    53399984   ddbjest127.seq     299001630
EST128                        96240    37352886   ddbjest128.seq     299002465
EST129                        92357    55936450   ddbjest129.seq     299001121
EST130                        93244    47100607   ddbjest130.seq     299002714
EST131                        88730    52509598   ddbjest131.seq     299003248
EST132                        90007    63346315   ddbjest132.seq     299000753
EST133                        86830    45462759   ddbjest133.seq     299000324
EST134                        88953    66873345   ddbjest134.seq     299003179
EST135                        87519    51786666   ddbjest135.seq     299001729
EST136                        92243    53345033   ddbjest136.seq     299001713
EST137                        89777    74190595   ddbjest137.seq     299003565
EST138                        82166    60443077   ddbjest138.seq     299000498
EST139                        81645    60362295   ddbjest139.seq     299000587
EST140                        83632    59042956   ddbjest140.seq     299000937
EST141                        84408    63463446   ddbjest141.seq     299002295
EST142                        79710    50730543   ddbjest142.seq     299001375
EST143                        81943    44340704   ddbjest143.seq     299001681
EST144                        88504    50633653   ddbjest144.seq     299001404
EST145                       112621    67542741   ddbjest145.seq     299000749
EST146                        92155    56679634   ddbjest146.seq     299001941
EST147                       132048    82832097   ddbjest147.seq     299001056
EST148                       136058    81395469   ddbjest148.seq     299001973
EST149                       101046    58418578   ddbjest149.seq     299001148
EST150                        79873    58622384   ddbjest150.seq     299001540
EST151                        85948    88451256   ddbjest151.seq     299002416
EST152                        96781    62554188   ddbjest152.seq     299002164
EST153                       101800    57202756   ddbjest153.seq     299002376
EST154                       101227    72215766   ddbjest154.seq     299001735
EST155                        76444    44149009   ddbjest155.seq     299001849
EST156                        58766    22033581   ddbjest156.seq     299005859
EST157                        56680    20013443   ddbjest157.seq     299002733
EST158                        57265    20796821   ddbjest158.seq     299004856
EST159                        56464    21509752   ddbjest159.seq     299002985
EST160                        56100    23433589   ddbjest160.seq     299000994
EST161                        57960    19655470   ddbjest161.seq     299002118
EST162                        58630    23064118   ddbjest162.seq     299003329
EST163                        56818    24029416   ddbjest163.seq     299002468
EST164                        55590    23047045   ddbjest164.seq     299003716
EST165                        55708    23753025   ddbjest165.seq     299004897
EST166                        56410    22822723   ddbjest166.seq     299004715
EST167                        56324    22149654   ddbjest167.seq     299003190
EST168                        53023    35983521   ddbjest168.seq     299005622
EST169                        93763    36103872   ddbjest169.seq     299001047
EST170                       112781    54826478   ddbjest170.seq     299003000
EST171                        88623    57371605   ddbjest171.seq     299000419
EST172                        89331    57405127   ddbjest172.seq     299000845
EST173                        86207    54132901   ddbjest173.seq     299002426
EST174                        99048    56459045   ddbjest174.seq     299003269
EST175                        87238    53284652   ddbjest175.seq     299001019
EST176                        86633    42909915   ddbjest176.seq     299001566
EST177                       127884    59468193   ddbjest177.seq     299003074
EST178                        94031    52785998   ddbjest178.seq     299002760
EST179                        85407    41183895   ddbjest179.seq     299002366
EST180                        87696    53851099   ddbjest180.seq     299001174
EST181                        93497    43779264   ddbjest181.seq     299002101
EST182                        91199    53987885   ddbjest182.seq     299001394
EST183                        84674    46010902   ddbjest183.seq     299000199
EST184                        87921    48115638   ddbjest184.seq     299002970
EST185                       110162    59023582   ddbjest185.seq     299000653
EST186                       102996    67749756   ddbjest186.seq     299002081
EST187                       111531    68568963   ddbjest187.seq     299000466
EST188                       125764    59793838   ddbjest188.seq     299000101
EST189                        97133    57137878   ddbjest189.seq     299003314
EST190                        93562    52618603   ddbjest190.seq     299002131
EST191                        95039    43084017   ddbjest191.seq     299001799
EST192                        93252    47994583   ddbjest192.seq     299000329
EST193                        79860    45911571   ddbjest193.seq     299002078
EST194                        87076    52712379   ddbjest194.seq     299001940
EST195                        86127    58522045   ddbjest195.seq     299000492
EST196                        84039    44957262   ddbjest196.seq     299002470
EST197                       111634    57705719   ddbjest197.seq     299002071
EST198                       102288    59606017   ddbjest198.seq     299001429
EST199                       142896    65964044   ddbjest199.seq     299000671
EST200                       124966    55252878   ddbjest200.seq     299001674
EST201                        87991    47201811   ddbjest201.seq     299000566
EST202                        92133    59140799   ddbjest202.seq     299001577
EST203                       101708    50719407   ddbjest203.seq     299001942
EST204                        89556    55456112   ddbjest204.seq     299000724
EST205                        79461    48799992   ddbjest205.seq     299003657
EST206                        69394    38509847   ddbjest206.seq     299002097
EST207                        83475    51066321   ddbjest207.seq     299000096
EST208                        89657    51567669   ddbjest208.seq     299000377
EST209                        85715    51854622   ddbjest209.seq     299000519
EST210                        91379    63683650   ddbjest210.seq     299003157
EST211                        81041    62488819   ddbjest211.seq     299000653
EST212                        77953    43761617   ddbjest212.seq     299004201
EST213                        94307    65397417   ddbjest213.seq     299002577
EST214                        98431    49599292   ddbjest214.seq     299001570
EST215                        84776    47634177   ddbjest215.seq     299003648
EST216                        81095    42577945   ddbjest216.seq     299000719
EST217                       111721    43023317   ddbjest217.seq     299001863
EST218                        90069    32789652   ddbjest218.seq     299001315
EST219                        95614    35213719   ddbjest219.seq     299002142
EST220                        92948    33617312   ddbjest220.seq     298999946
EST221                       100835    34544115   ddbjest221.seq     299000553
EST222                        90025    37500543   ddbjest222.seq     299003032
EST223                        32144    10738515   ddbjest223.seq      91081134
GSS1                         104907    76505925   ddbjgss1.seq       299001393
GSS2                         100338    71971324   ddbjgss2.seq       299000779
GSS3                         117492    57578838   ddbjgss3.seq       299000914
GSS4                          98687    75350490   ddbjgss4.seq       299000268
GSS5                          82039    68875705   ddbjgss5.seq       299003149
GSS6                          79662    73825737   ddbjgss6.seq       299003473
GSS7                          82883    58769074   ddbjgss7.seq       299000789
GSS8                         110434    45848265   ddbjgss8.seq       299001957
GSS9                         117038    47829779   ddbjgss9.seq       299001170
GSS10                        112945    52931845   ddbjgss10.seq      299002417
GSS11                        102194    53418434   ddbjgss11.seq      299001263
GSS12                        102384    52104662   ddbjgss12.seq      299002086
GSS13                         98639    49559246   ddbjgss13.seq      299001722
GSS14                         99989    50499503   ddbjgss14.seq      299001402
GSS15                         92618    47262109   ddbjgss15.seq      299001562
GSS16                         97173    54190471   ddbjgss16.seq      299002803
GSS17                         89283    47603990   ddbjgss17.seq      299003422
GSS18                         94936    55525483   ddbjgss18.seq      299000974
GSS19                         91404    52423564   ddbjgss19.seq      299001010
GSS20                         94198    47011880   ddbjgss20.seq      299001150
GSS21                         94463    52692274   ddbjgss21.seq      299003138
GSS22                         81865    38273791   ddbjgss22.seq      299002741
GSS23                         73577    38001065   ddbjgss23.seq      299001453
GSS24                         75568    32711521   ddbjgss24.seq      299000748
GSS25                         84573    50272103   ddbjgss25.seq      299002941
GSS26                         74885    34473637   ddbjgss26.seq      299000577
GSS27                         89255    53261612   ddbjgss27.seq      299000936
GSS28                         79491    31445103   ddbjgss28.seq      299002946
GSS29                         81247    39296914   ddbjgss29.seq      299002791
GSS30                         83077    42240884   ddbjgss30.seq      299003592
GSS31                         93986    50019887   ddbjgss31.seq      299002332
GSS32                         91808    59693030   ddbjgss32.seq      299001801
GSS33                        100605    49598290   ddbjgss33.seq      299001667
GSS34                         97688    52195793   ddbjgss34.seq      299000173
GSS35                        108476    65357078   ddbjgss35.seq      299000875
GSS36                        119466    79365122   ddbjgss36.seq      299001468
GSS37                        115202    63463575   ddbjgss37.seq      299000158
GSS38                        110386    52782792   ddbjgss38.seq      299001667
GSS39                        107131    45280584   ddbjgss39.seq      299000465
GSS40                        111299    74363470   ddbjgss40.seq      299000358
GSS41                        117840    65789411   ddbjgss41.seq      299000070
GSS42                        101344    62688168   ddbjgss42.seq      299000476
GSS43                         93951    62917486   ddbjgss43.seq      299002680
GSS44                         93050    61405280   ddbjgss44.seq      299002236
GSS45                        101063    52416441   ddbjgss45.seq      299001704
GSS46                        108059    70420006   ddbjgss46.seq      299001371
GSS47                        111129    87545320   ddbjgss47.seq      299001392
GSS48                        112101    64423188   ddbjgss48.seq      299001254
GSS49                        114438    75500155   ddbjgss49.seq      299000565
GSS50                         99012    56851234   ddbjgss50.seq      299000562
GSS51                        102118    62897612   ddbjgss51.seq      299001237
GSS52                        116914    55054461   ddbjgss52.seq      299002043
GSS53                        111026    65480343   ddbjgss53.seq      299002197
GSS54                         98320    85991213   ddbjgss54.seq      299000178
GSS55                         96777    96645893   ddbjgss55.seq      299001762
GSS56                        116531    85158105   ddbjgss56.seq      299000791
GSS57                         85685    56444348   ddbjgss57.seq      299000421
GSS58                         93639    65989881   ddbjgss58.seq      299001835
GSS59                        114029    84526514   ddbjgss59.seq      299001853
GSS60                        108818    66325622   ddbjgss60.seq      299002096
GSS61                        114075    73866741   ddbjgss61.seq      299002416
GSS62                        125503    72196941   ddbjgss62.seq      299000725
GSS63                        127739    69522197   ddbjgss63.seq      299002350
GSS64                        128601    68396595   ddbjgss64.seq      299000199
GSS65                        130127    66407111   ddbjgss65.seq      299000150
GSS66                        130224    66280561   ddbjgss66.seq      299001389
GSS67                        130003    66568718   ddbjgss67.seq      299001431
GSS68                        126163    71439227   ddbjgss68.seq      299001609
GSS69                        114210    88613270   ddbjgss69.seq      299000173
GSS70                        113168    89171245   ddbjgss70.seq      299002031
GSS71                        111735    88586767   ddbjgss71.seq      299001921
GSS72                        112604    80595229   ddbjgss72.seq      299001209
GSS73                        121491    35542124   ddbjgss73.seq      299001590
GSS74                        118953    46096445   ddbjgss74.seq      299000031
GSS75                        104048    60614233   ddbjgss75.seq      299002580
GSS76                        108900    70894048   ddbjgss76.seq      298999963
GSS77                        105342    80532721   ddbjgss77.seq      299001279
GSS78                        100330   101255713   ddbjgss78.seq      299001272
GSS79                        108295    65861692   ddbjgss79.seq      299001576
GSS80                         59585    39505822   ddbjgss80.seq      159393843
HTC1                          37946    68171555   ddbjhtc1.seq       299002514
HTC2                          47488    84572532   ddbjhtc2.seq       299002374
HTC3                          85615    73123771   ddbjhtc3.seq       245841882
HTG1                           1584   227725508   ddbjhtg1.seq       299235498
HTG2                           3381   224532755   ddbjhtg2.seq       299191997
HTG3                           3059   226010579   ddbjhtg3.seq       299002220
HTG4                           1900   226002913   ddbjhtg4.seq       299123227
HTG5                           1540   224771213   ddbjhtg5.seq       299241398
HTG6                           1510   224843980   ddbjhtg6.seq       299106774
HTG7                           1548   224594959   ddbjhtg7.seq       299202505
HTG8                           1345   227888615   ddbjhtg8.seq       299018343
HTG9                           1830   223027185   ddbjhtg9.seq       299314472
HTG10                          1136   229941218   ddbjhtg10.seq      299349563
HTG11                           897   230138044   ddbjhtg11.seq      299074970
HTG12                           891   230123837   ddbjhtg12.seq      299071549
HTG13                           957   229981984   ddbjhtg13.seq      299097551
HTG14                           913   230255622   ddbjhtg14.seq      299273904
HTG15                          1626   223381394   ddbjhtg15.seq      299033062
HTG16                          1764   221665163   ddbjhtg16.seq      299137069
HTG17                          1298   226838978   ddbjhtg17.seq      299094902
HTG18                          1112   228437999   ddbjhtg18.seq      299162879
HTG19                           953   229678136   ddbjhtg19.seq      299027052
HTG20                          1162   228431515   ddbjhtg20.seq      299154153
HTG21                          1069   229424515   ddbjhtg21.seq      299563856
HTG22                           975   229608187   ddbjhtg22.seq      299216911
HTG23                           996   229531217   ddbjhtg23.seq      299087913
HTG24                          1035   229408431   ddbjhtg24.seq      299068052
HTG25                          1114   228806415   ddbjhtg25.seq      299073263
HTG26                          1173   228394226   ddbjhtg26.seq      299175447
HTG27                          1118   228737874   ddbjhtg27.seq      299114303
HTG28                          1182   228376784   ddbjhtg28.seq      299131138
HTG29                          1065   229340291   ddbjhtg29.seq      299271452
HTG30                          1057   229583831   ddbjhtg30.seq      299027390
HTG31                          1200   228607396   ddbjhtg31.seq      299217650
HTG32                          1051   229284651   ddbjhtg32.seq      299026461
HTG33                          1033   229633497   ddbjhtg33.seq      299319249
HTG34                          1033   229398693   ddbjhtg34.seq      299145722
HTG35                          1109   228993773   ddbjhtg35.seq      299195433
HTG36                          1147   229445394   ddbjhtg36.seq      298999952
HTG37                          1144   228829616   ddbjhtg37.seq      299025993
HTG38                          1244   228548444   ddbjhtg38.seq      299304327
HTG39                          1437   226515061   ddbjhtg39.seq      299145289
HTG40                          1439   228027906   ddbjhtg40.seq      299062567
HTG41                          1381   228248953   ddbjhtg41.seq      299114996
HTG42                          1366   227225867   ddbjhtg42.seq      299179827
HTG43                          1321   229117583   ddbjhtg43.seq      299376834
HTG44                          1451   229253122   ddbjhtg44.seq      299171226
HTG45                          1422   230029444   ddbjhtg45.seq      299174602
HTG46                          1452   229232404   ddbjhtg46.seq      298746685
HTG47                          1290   230098935   ddbjhtg47.seq      301363685
HTG48                          1476   230889439   ddbjhtg48.seq      299164208
HTG49                          1270   231524413   ddbjhtg49.seq      299110544
HTG50                          1201   232222430   ddbjhtg50.seq      299345607
HTG51                          1244   230813135   ddbjhtg51.seq      299188137
HTG52                           242    30207754   ddbjhtg52.seq       39335006
human1                        12733   193350475   ddbjhum1.seq       299133164
human2                         1612   212441790   ddbjhum2.seq       299182103
human3                         1572   217307497   ddbjhum3.seq       299258369
human4                         1351   206550698   ddbjhum4.seq       299276174
human5                         1449   213575045   ddbjhum5.seq       299072185
human6                         1464   210368255   ddbjhum6.seq       299026033
human7                         1545   204265077   ddbjhum7.seq       299170718
human8                         1638   213552902   ddbjhum8.seq       299104613
human9                         1497   208468457   ddbjhum9.seq       299039938
human10                        1797   209539412   ddbjhum10.seq      299043834
human11                        1951   212875405   ddbjhum11.seq      299175177
human12                       33930   168415784   ddbjhum12.seq      299001376
human13                       68202   101327126   ddbjhum13.seq      299000139
human14                       15979   171846295   ddbjhum14.seq      299108644
human15                        3556   208102200   ddbjhum15.seq      299208452
human16                        2118   216589197   ddbjhum16.seq      299139165
human17                        2485   217193915   ddbjhum17.seq      299005855
human18                        5235   219744232   ddbjhum18.seq      299053920
human19                        1729   222590286   ddbjhum19.seq      299100599
human20                       45472    95239815   ddbjhum20.seq      299008132
human21                      133818    94357271   ddbjhum21.seq      299001742
human22                      178943    72499462   ddbjhum22.seq      299003321
human23                      177645    94436047   ddbjhum23.seq      299014983
human24                       70719   113369003   ddbjhum24.seq      290480799
invertebrates1                12178   208003835   ddbjinv1.seq       299162120
invertebrates2                 8936   180013392   ddbjinv2.seq       299001251
invertebrates3                91393    90208242   ddbjinv3.seq       299002682
invertebrates4                65359   106982770   ddbjinv4.seq       299003711
invertebrates5                54321   158543175   ddbjinv5.seq       299021647
invertebrates6                 4030    40634861   ddbjinv6.seq        78704460
mammals                       57857    78621055   ddbjmam.seq        212137278
patens1                      255331    88976197   ddbjpat1.seq       299000128
patens2                      218261   104989895   ddbjpat2.seq       299000587
patens3                      166023    99470597   ddbjpat3.seq       299010842
patens4                      130393   132462963   ddbjpat4.seq       299195714
patens5                      159588   108005642   ddbjpat5.seq       299109644
patens6                      154149   108814188   ddbjpat6.seq       299001786
patens7                      177247    66909502   ddbjpat7.seq       299001117
patens8                      125071    73823088   ddbjpat8.seq       299001654
patens9                      135099    62499694   ddbjpat9.seq       299000195
patens10                     120030    42754994   ddbjpat10.seq      179360304
phages                         2458    11614985   ddbjphg.seq         29423339
plants1                       25442   166259950   ddbjpln1.seq       299280249
plants2                       40219   163267757   ddbjpln2.seq       299000734
plants3                       89243    94050447   ddbjpln3.seq       299002134
plants4                       65767    64600911   ddbjpln4.seq       299006723
plants5                       24447   123268314   ddbjpln5.seq       299108257
plants6                        1836   208810587   ddbjpln6.seq       299126303
plants7                       59867   112390065   ddbjpln7.seq       299001424
plants8                       73395   103072416   ddbjpln8.seq       299008810
plants9                       20439    45542661   ddbjpln9.seq       113325792
primates                      25447   165081839   ddbjpri.seq        262423891
rodents1                       7618   206651191   ddbjrod1.seq       299100875
rodents2                       1058   210201435   ddbjrod2.seq       299068632
rodents3                       1177   215776183   ddbjrod3.seq       299028446
rodents4                       1194   216681701   ddbjrod4.seq       299016364
rodents5                      33840   168775661   ddbjrod5.seq       299071966
rodents6                       1423   232071217   ddbjrod6.seq       299184825
rodents7                       1470   231221134   ddbjrod7.seq       299072490
rodents8                      25069   168674944   ddbjrod8.seq       299006595
rodents9                      52444   129588642   ddbjrod9.seq       299004224
rodents10                      9653    11509998   ddbjrod10.seq       35697406
STS1                         104411    57884105   ddbjsts1.seq       299000817
STS2                         105147    40669833   ddbjsts2.seq       299001341
STS3                          53761    24027594   ddbjsts3.seq       144579928
synthetic DNAs                12056    18742788   ddbjsyn.seq         50444999
TPA                            3952    13165310   ddbjtpa.seq         29126809
unannotated sequences          1341      603111   ddbjuna.seq          3239870
viruses1                      86374    76922854   ddbjvrl1.seq       299001623
viruses2                      87324    77261743   ddbjvrl2.seq       299001471
viruses3                      46332    46224274   ddbjvrl3.seq       162750121
vertebrates1                  72284   111528263   ddbjvrt1.seq       299259018
vertebrates2                  37187   165655988   ddbjvrt2.seq       299002446
vertebrates3                   6099   210806508   ddbjvrt3.seq       299017361
vertebrates4                  26688    47874645   ddbjvrt4.seq       115012305
Accession number index file       0           0   ddbjacc.idx       1274465847
Gene name index file              0           0   ddbjgen.idx         58471149
Journal citation index file       0           0   ddbjjou.idx       1445186018
Keyword phrase index file         0           0   ddbjkey.idx       1169965682
-------------------------------------------------------
EST: expressed sequence tag
CON: Contig sequences
GSS: genome survey sequence
HTC: high throughput cDNA
HTG: high throughput genome sequence
STS: sequence tagged site
TPA: third party annotation
Last modified: Jan. 07, 2010