URL : http://getentry.ddbj.nig.ac.jp/top-e.html
| ID | Accession Number |
| Database | DNA database:DDBJ/EMBL/GenBank INSD. |
| Output format | flatfile(DDBJ) |
| Result | html |
| Limit | 10 |
Input the Accession Number(s). Multiple number search, range search, and version seach are available。
| version search |
|
AB669632.1 AB669632.2 |
| multiple number search |
|
AB669632.1,AB669632.2,AB669633.1,AB669633.2 AK377101-AK377200,AK377210,AK377211 |
| range search |
|
AB1234-AB1236 FY782000-FY7830 AK377101 - AK377200,AK377211- AK388100 |
Select the database. The output format should be selected from either "database specific format" or FASTA.
Database
| DDBJ/EMBL/GenBank | International Nucleotide Sequence Databases(INSD) |
| MGA | Mass sequence for Genome Annotation(MGA) |
*DDBJ/EMBL/GenBank includes the following databases.
|
*"4 letters + 8 digits" accession numbers(WGS and TSA) and TPA are not contained in the DDBJ releases.
*Please refrer the Latest Release Information, for the current status of searchable databases and related information.
Output format
| flatfile(DDBJ) | DDBJ flat file format |
| Total nt seq FASTA | nucleotide total sequence in FASTA format |
| CDS Amino acid seq FASTA | amino acid translated sequence of CDS region in FASTA format |
| CDS nt seq FASTA | nucleotide sequence of CDS region in FASTA |
| INSD-XML_v1.4 | INSD-XML_v1.4 format |
*These 5 format types are selectable only after specification of "DDBJ/EMBL/GenBank".
*When the MGA is selected as the target database, only "flatfile" can be specified.
Database
| UniProt | Amino acid database (UniProt/Swiss-Prot and UniProt/TrEMBL) |
| PDB | 3D structure database of protein |
| DAD | translated sequences database extracting from DDBJ |
| Patent | Amino acid data from JPO and KIPO |
*Please refrer Latest Release Information, for the current status of searchable databases and related information.
Output Format
| default | Database specific format | |
| Amino acid seq FASTA | Amino acid sequence in FASTA format | available in UniProt, DAD, Patent |
| Nucleotide seq FASTA (for DAD) | Nucleotide sequence in FASTA format | DAD limited |
| seqres | PDB specific amino acid sequence FASTA format | PDB limited |
*Output format of Protein database search differs depending on the selected target databases.
| default | html |
| html | HTML (with link to ACCESSION, ORGANISM, etc) |
| text | text |
| gz | gzip compressed |
*The name of the gzip files corresponding to the specified formats are as follows.
|
[DNA] flatfile
[DNA] xml [DNA] fasta [DNA] trans [DNA] cds [Protein] flatfile [Protein] fasta [Protein] cds
flatfile.txt.gz
insd.xml.gz fasta_na.txt.gz cds_aa.txt.gz cds_na.txt.gz flatfile.txt.gz fasta_aa.txt.gz cds_aa.txt.gz |
| default | 10 entries |
| specify the number | specified number of entries |
| 0≥ | no limit |
"getentry" is available from WebAPI program, as well as a simple web form, which calls up the data directly.
WebAPI of getentry consists of two following programs.
| getentry | Get the flat file of the specified accession number (ID of entries in the database) |
| gethistory | Get the revision history of the specified accession number (ID of entries in the database) Revision history of the amino acid sequence derived from the Patent Office has not been taken so far. |
There are the following 2 methods.
| GET method | http://getentry.ddbj.nig.ac.jp/getentry?database=database name&accession_number=accession number&additional parameters (optional) |
| smart URL | http://getentry.ddbj.nig.ac.jp/getentry/database name/accession number http://getentry.ddbj.nig.ac.jp/getentry/database name/accession number/?additional parameters (optional) http://getentry.ddbj.nig.ac.jp/getentry/database name/accession number/revision ID/?additional parameters (optional) |
example
accession number(mandatory):Specify the accession number.
| version number |
|
| multiple accession search |
|
| range search |
|
example (upper:Get method / lower: smart URL)
It may take a long time to display a large number of results.
According to the performance of the browser, all of that might not be displayed.
database(optional):Specify the database for searching.
| DNA | na | DDBJ/EMBL/GenBank | International Nucleotide Sequence Databases(INSD) |
| mga | MGA | Mass sequence for Genome Annotation(MGA) | |
| Protein | aa | DAD, Patent, UniProt, PDB | search these 4 dbs in this order |
| uniprot | UniProt | Amino acid database (UniProt/Swiss-Prot and UniProt/TrEMBL) | |
| pdb | PDB | 3D structure database of protein | |
| dad | DAD | translated sequences database extracting from DDBJ | |
| patent_aa | Patent | Amino acid data from JPO and KIPO |
*Omitting the database specification is processed as t
*DDBJ/EMBL/GenBank includes the following databases.
|
*"4 letters + 8 digits" accession numbers(WGS and TSA) and TPA are not contained in the DDBJ releases.
*Please refrer Latest Release Information, for the current status of searchable databases and related information.
example (upper:Get method / lower: smart URL)
revision(optional): Search the revised entry at the specified time.
| general | yyyy-MM-dd hh:mm:ss |
| release | yyyy-MM-dd hh:mm:ss release |
*When both the version number and revision are specified, revision takes priority.
example (upper:Get method / lower: smart URL)
| default | flatfile |
| flatfile | DDBJ flat file format |
| xml | INSD-Seq-XML version 1.4 format |
| fasta | [DNA]Total nt seq FASTA |
| [Protein] Amino acid seq FASTA | |
| trans | [DNA] CDS amino acid seq FASTA |
| cds | [DNA] CDS nt seq FASTA |
| [DAD limited] Nucleotide seq FASTA (for DAD) | |
| seqres | [PDB limited] PDB amino acid |
Available output formats by specified database are as follows.
| DNA database | ||
|---|---|---|
| DDBJ / EMBL / GenBank MGA |
flatfile(DDBJ), Total nt seq FASTA, CDS amino acid seq FASTA, CDS nt seq FASTA, INSD-XML_v1.4 |
|
| Protein database | ||
| UniProt | default, Amino acid seq FASTA | |
| PDB | default, seqres | |
| DAD | default, Amino acid seq FASTA, nt seq FASTA | |
| Patent | default, Amino acid seq FASTA | |
example (upper:Get method / lower: smart URL)
LOCUS AB628096 390 bp RNA linear VRL 24-FEB-2012
DEFINITION Human rhinovirus C gene for polyprotein, partial cds, strain:
HRV/Yamaguchi/2010/89.
ACCESSION AB628096
VERSION AB628096.1
KEYWORDS .
SOURCE Human rhinovirus C
ORGANISM Human rhinovirus C
Viruses; ssRNA positive-strand viruses, no DNA stage;
Picornavirales; Picornaviridae; Enterovirus.
REFERENCE 1 (bases 1 to 390)
AUTHORS Kobayashi,M., Arakawa,M., Okamoto,R., Tsukagoshi,H., Ryo,A.,
Mizuta,K., Hasegawa,S., Hirano,R., Wakiguchi,H., Kudo,K.,
Tanaka,R., Morita,Y., Noda,M., Kozawa,K., Ichiyama,T., Shirabe,K.
and Kimura,H.
TITLE Direct Submission
JOURNAL Submitted (06-MAY-2011) to the DDBJ/EMBL/GenBank databases.
Contact:Miho Kobayashi
Gunma Prefectural Institute of Public Health and Environmental
Sciences; Kamiokimachi 378, Maebashi, Gunma 371-0052, Japan
REFERENCE 2
AUTHORS Arakawa,M., Okamoto-Nakagawa,R., Toda,S., Tsukagoshi,H.,
Kobayashi,M., Ryo,A., Mizuta,K., Hasegawa,S., Hirano,R.,
Wakiguchi,H., Kudo,K., Tanaka,R., Morita,Y., Noda,M., Kozawa,K.,
Ichiyama,T., Shirabe,K. and Kimura,H.
TITLE Molecular epidemiological study of human rhinovirus species A, B
and C from patients with acute respiratory illnesses in Japan
JOURNAL J. Med. Microbiol. 61, 410-419 (2012)
REMARK DOI:10.1099/jmm.0.035006-0
COMMENT
FEATURES Location/Qualifiers
source 1..390
/collection_date="14-Jan-2010"
/country="Japan:Yamaguchi"
/db_xref="taxon:463676"
/host="Homo sapiens"
/isolation_source="Nasopharyngeal swab"
/mol_type="genomic RNA"
/organism="Human rhinovirus C"
/strain="HRV/Yamaguchi/2010/89"
CDS 1..>390
/codon_start=1
/product="polyprotein"
/protein_id="BAK22546.1"
/transl_table=1
/translation="MGAQVSKQNVGSHENSVSATGGSVIKYFNINYYKDSASSGLTKQ
DFSQDPSKFTQPLAEALTNPALMSPTVEACGMSDRLKQITIGNSTITTQDTLNSILAY
GEWPKYLSDLDASSVDKPTHPETSSDRF"
BASE COUNT 124 a 95 c 77 g 94 t
ORIGIN
1 atgggcgcac aggtgagcaa gcaaaatgtc ggctcgcacg aaaattcagt ctcagccacg
61 ggtggatccg tgattaagta tttcaacatc aattactaca aggattctgc tagctctggc
121 ttgactaaac aagatttttc ccaagaccca tcgaaattca cacaacctct agcagaagca
181 cttacaaatc cagctttaat gtcaccaact gttgaagcat gtgggatgtc cgataggctt
241 aaacaaatta ctatcgggaa ttccactata acaacacaag atacactaaa ctctatactg
301 gcatatgggg agtggcccaa atacttgagt gacctggacg cttcctcagt ggataagcct
361 acccacccag agacatcatc tgatagattt
//
>BD500001|JP 2000316586-A/3: Recombinant microorganism expressing small rubber particle-bound protein (SRPP). MAEEVEEERLKYLDFVRAAGVYAVDSFSTLYLYAKDISGPLKPGVDTIENVVKTVVTPVY YIPLEAVKFVDKTVDVSVTSLDGVVPPVIKQVSAQTYSVAQDAPRIVLDVASSVFNTGVQ EGAKALYANLEPKAEQYAVITWRALNKLPLVPQVANVVVPTAVYFSEKYNDVVRGTTEQG YRVSSYLPLLPTEKITKVFGDEAS
>AB601234|AB601234.1 Ainsliaea faurieana chs gene for chalcone synthase, partial cds, haplotype: 2. ggaccttgctaaaaacaataagggctcacatgtccttgttgtctgctctgagatcattgc ttccatttttcgtagaccagataagaaccacattgtcagccaagctctctttggggatgg agcttctgcgctcattgtgggttcagacccagacttctccaaggaacatccattattcaa gattgtgtctacaactcagacaatcttacagaacactgaaagggcgatgaacttacaatt gagggaagaagggttgaccattcacctgcacagggatgtaccccagatgacatcaaagaa tatagaggaggcattagtgcacatatttttgccactgggcataagagactggaactcg
<?xml version="1.0"?>
<!DOCTYPE INSDSet SYSTEM "INSD_INSDSeq.dtd">
-<INSDSet>
-<INSDSeq> <INSDSeq_locus>AB601234</INSDSeq_locus>
<INSDSeq_length>358</INSDSeq_length>
<INSDSeq_moltype>DNA</INSDSeq_moltype>
<INSDSeq_topology>linear</INSDSeq_topology>
<INSDSeq_division>PLN</INSDSeq_division>
<INSDSeq_update-date>18-MAY-2011</INSDSeq_update-date>
<INSDSeq_definition>Ainsliaea faurieana chs gene for chalcone ......
<INSDSeq_primary-accession>AB601234</INSDSeq_primary-accession>
<INSDSeq_accession-version>AB601234.1</INSDSeq_accession-version>
<INSDSeq_source>Ainsliaea faurieana</INSDSeq_source>
<INSDSeq_organism>Ainsliaea faurieana</INSDSeq_organism>
<INSDSeq_taxonomy>Eukaryota; Viridiplantae; Streptophyta; .......
-<INSDSeq_references>
-<INSDReference>
<INSDReference_reference>1</INSDReference_reference>
<INSDReference_position>1..358</INSDReference_position>
-<INSDReference_authors> <INSDAuthor>Mitsui,Y.</INSDAuthor>
<INSDAuthor>Setoguchi,H.</INSDAuthor> </INSDReference_authors>
<INSDReference_title>Direct Submission</INSDReference_title>
<INSDReference_journal>Submitted (17-NOV-2010) to the DDBJ/.....
-<INSDReference>
------- skip -----
>HE963104-1|CCJ27876.1|111|<1..111|Streptococcus thermophilus|predicted..... gggttgtcctgtgatgagggaatgctggcagtaggaggacttggtgctgtaggtggcccg tggggagctgtcggtggggtgttagtaggtgcagccttatactgtttctaa >HE963104-2|CCJ27877.1|201|130..330|Streptococcus thermophilus|hypothetical..... atgaataataaacaacttgaaagatttaaaaaactggatacaaatgcattgtctaatgta agtggtcaaggctatggtgctcaatgtgttattggtactgccggaatgacgattgtcggt gcagctttctttggcatcgcaggtgcaggagctggatttgcaggcggtagcacagcattt tgttatggtacagctgaataa >HE963104-3|CCJ27878.1|219|686..>904|Streptococcus thermophilus|..... atggcaactcaaacaattgaaaactttaacacccttaacctcgaaacacttgctagtgtt gaaggaggtggatgtggttggagaggcgcaggtggagcgactgttcaaggagctatcggg ggagcgtttggaggtaatgtagttttaccagttgtaggctcagttcctggttatctagct ggtggtgttctaggtggtgcaggtggtactgttgcctat
>JQ677812-1|AFN26948.1|74|Triticum aestivum (bread wheat) HKT1;5 HLAGYSLMLVYLSVVSGARAVLTGKRISLHTFSVFTVVSTFANCGFVPNNEAMIAFRSFP GLLLLVMPHVLLGI
>AB000714-1|BAA22986.1|663|199..861|Homo sapiens|RVP1 atgtccatgggcctggagatcacgggcaccgcgctggccgtgctgggctggctgggcacc atcgtgtgctgcgcgttgcccatgtggcgcgtgtcggccttcatcggcagcaacatcatc acgtcgcagaacatctgggagggcctgtggatgaactgcgtggtgcagagcaccggccag atgcagtgcaaggtgtacgactcgctgctggcactgccacaggaccttcaggcggcccgc gccctcatcgtggtggccatcctgctggccgccttcgggctgctagtggcgctggtgggc gcccagtgcaccaactgcgtgcaggacgacacggccaaggccaagatcaccatcgtggca ggcgtgctgttccttctcgccgccctgctcaccctcgtgccggtgtcctggtcggccaac accattatccgggacttctacaaccccgtggtgcccgaggcgcagaagcgcgagatgggc gcgggcctgtacgtgggctgggcggccgcggcgctgcagctgctggggggcgcgctgctc tgctgctcgtgtcccccacgcgagaagaagtacacggccaccaaggtcgtctactccgcg ccgcgctccaccggcccgggagccagcctgggcacaggctacgaccgcaaggactacgtc taa
>100d_A mol:na length:10 DNA/RNA (5'-R(*CP*)-D(*CP*GP*GP*CP*GP*CP*CP*G CCGGCGCCGG >100d_B mol:na length:10 DNA/RNA (5'-R(*CP*)-D(*CP*GP*GP*CP*GP*CP*CP*G CCGGCGCCGG >101d_A mol:na length:12 DNA (5'-D(*CP*GP*CP*GP*AP*AP*TP*TP*(CBR)P*GP* CGCGAATTCGCG >101d_B mol:na length:12 DNA (5'-D(*CP*GP*CP*GP*AP*AP*TP*TP*(CBR)P*GP* CGCGAATTCGCG >101m_A mol:protein length:154 MYOGLOBIN----skip----
filetype(optional):Specify the filetype for the result
| default | text |
| html | HTML(links to ACCESSION, ORGANISM, etc) |
| text | TEXT |
| gz | gz compressed |
*The name of the gzip files corresponding to the specified formats are as follows.
|
[DNA]flatfile
[DNA]xml [DNA]fasta [DNA]trans [DNA]cds [Protein]flatfile [Protein]fasta [Protein]cds
flatfile.txt.gz
insd.xml.gz fasta_na.txt.gz cds_aa.txt.gz cds_na.txt.gz flatfile.txt.gz fasta_aa.txt.gz cds_aa.txt.gz |
example (upper:Get method / lower: smart URL)

LOCUS FW383979 2675 bp DNA linear PAT 14-OCT-2010
DEFINITION JP 2006521812-A/1: GENETIC POLYMORPHISMS ASSOCIATED WITH RHEUMATOID
ARTHRITIS, METHODS OF DETECTION AND USES THEREOF.
ACCESSION FW383979
VERSION FW383979.1
KEYWORDS JP 2006521812-A/1.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2675)
AUTHORS Alexander,H.C., Bigobikku,A.B. and Kagiru,M.
TITLE GENETIC POLYMORPHISMS ASSOCIATED WITH RHEUMATOID
ARTHRITIS, METHODS
OF DETECTION AND USES THEREOF
JOURNAL Patent: JP 2006521812-A 1 28-Sep-2006;
APLERA CORPORATION
COMMENT OS Homo sapiens
PN JP 2006521812-A/1
PD 28-Sep-2006
show_suppressed (optional):To display the suppressed data.
| true | display the suppressed data. |
| false | NOT display the suppressed data |
example (upper:Get method / lower: smart URL)
limit(optional): Sets an upper limit of the data acquisition
| default | 10 entries |
| specify the number | specified number of entries |
| 0 | no limit |
example (upper:Get method / lower: smart URL)
trace(optional):When Secondary Accession numberis specified, the result transfers to that of Primary Accession number
| true | display Primary Accession number |
| false | display Secondary Accession number |
example (upper:Get method / lower: smart URL)
accession number(mandatory):Specify the accession number for searching.
Specification method is the same as getentry.
example (upper:Get method / lower: smart URL)
AB628096 1 2012-05-25 12:00:00 release 2012-05-25 12:00:00 release live 1 2012-02-24 07:02:55 2012-02-24 07:02:55 live 1 2011-11-25 11:27:22 release 2011-11-25 11:27:22 release live 1 2011-10-22 23:01:47 2011-10-22 23:01:47 live 1 2011-08-26 10:33:50 release 2011-08-26 10:33:50 release live 1 2011-05-27 12:38:45 release 2011-05-27 12:38:45 release live 1 2011-05-11 23:09:49 2011-05-11 23:09:49 live
History of the amino acid sequence derived from the Patent Office is not available.
database(optional):Specify the database for searching.
| default | na |
| DNA | na |
When the specified database does not correspond to gethistory function, an empty result is returned.
example (upper:Get method / lower: smart URL)
BAET01000001 1 2015-09-15 16:20:47 2015-09-15 16:20:47 live 1 2014-06-28 09:14:29 2014-06-28 09:14:29 live 1 2012-06-07 07:05:36 2012-06-07 07:05:36 live 1 2012-06-01 07:05:51 2012-06-01 07:05:51 live 1 2012-03-10 07:10:00 2012-03-10 07:10:00 live 1 2012-03-10 07:03:37 2012-03-10 07:03:37 live 1 2012-02-21 07:03:15 2012-02-21 07:03:15 live
filetype(optional):Specify the filetype for the result.
| default | text |
| html | HTML |
| text | TEXT |
example (upper:Get method / lower: smart URL)
| accession | version | revision | change | state |
|---|---|---|---|---|
| AB628096 | 1 | 2015-05-29 18:00:00 release | 2015-05-29 18:00:00 release | live |
| 2015-02-27 14:00:00 release | 2015-02-27 14:00:00 release | live | ||
| 2014-11-25 13:00:00 release | 2014-11-25 13:00:00 release | live | ||
| 2014-08-29 21:00:00 release | 2014-08-29 21:00:00 release | live | ||
| 2014-05-30 12:00:00 release | 2014-05-30 12:00:00 release | live | ||
| 2014-02-21 12:00:00 release | 2014-02-21 12:00:00 release | live | ||
| 2013-11-29 12:00:00 release | 2013-11-29 12:00:00 release | live | ||
| 2013-08-30 07:00:00 release | 2013-08-30 07:00:00 release | live | ||
| 2013-05-24 12:00:00 release | 2013-05-24 12:00:00 release | live | ||
| 2013-02-22 12:00:00 release | 2013-02-22 12:00:00 release | live | ||
| 2012-11-22 15:00:00 release | 2012-11-22 15:00:00 release | live | ||
| 2012-08-24 12:00:00 release | 2012-08-24 12:00:00 release | live | ||
| 2012-05-25 12:00:00 release | 2012-05-25 12:00:00 release | live | ||
| 2012-02-24 07:17:46 | 2012-02-24 07:17:46 | live | ||
| 2012-02-24 07:02:55 | 2012-02-24 07:02:55 | live | ||
| 2011-11-25 11:27:22 release | 2011-11-25 11:27:22 release | live | ||
| 2011-10-22 23:01:47 | 2011-10-22 23:01:47 | live | ||
| 2011-08-26 10:33:50 release | 2011-08-26 10:33:50 release | live | ||
| 2011-05-27 12:38:45 release | 2011-05-27 12:38:45 release | live | ||
| 2011-05-11 23:09:49 | 2011-05-11 23:09:49 | live |
http://getentry.ddbj.nig.ac.jp/getentry?database=database name&accession_number=accession number&additional parameters (optional)
http://getentry.ddbj.nig.ac.jp/getentry/database name/accession number
http://getentry.ddbj.nig.ac.jp/getentry/database name/accession number/?additional parameters (optional)
For example,
a link to AB000001 is
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=AB000001
http://getentry.ddbj.nig.ac.jp/getentry/na/AB000001
a link to BD500001, an entry of the amino acid sequence originated in the Patent is not available.
http://getentry.ddbj.nig.ac.jp/getentry?database=aa&accession_number=BD500001
http://getentry.ddbj.nig.ac.jp/getentry/patent_aa/BD500001
As a practical case, please crick the following number to see how the entry can be viewed.
AB000001
BD500001
Creating links to DRA entries is different from the above method. Please refer to the DRA Web site.