getentry HELP

  

About getentry

  • "getentry" is a DDBJ flat file search system, by accession numbers.
  • "getentry" is available from WebAPI program, as well as a simple web form, which call up the data directly.
  • WebAPI also provides a new function "gethistory" (revision history search)
  • "Keyword search of DDBJ flat file" which was implemented in the former getentry (-2012.02) can is avialable in the ARSA

Search by web input form

URL: http://getentry.ddbj.nig.ac.jp/top-e.html

 

  

WebAPI programs and URLs

WebAPI of new getentry consists of two following programs.

getentry get the flat file of the specified accession number (ID of entries in the database)
gethistory
(new)
get the update history of the specified accession number (ID of entries in the database

* Update history of the amino acid sequence derived from the Patent Office has not been taken so far.

How to specify the parameter

There are the following 2 methods.

  

GET method
  • http://getentry.ddbj.nig.ac.jp/getentry?database=database name&accession_number=accession number&additional parameters (optional)
smart URL
  • http://getentry.ddbj.nig.ac.jp/getentry/database name/accession number
  • http://getentry.ddbj.nig.ac.jp/getentry/database name/accession number/?additional parameters (optional)
  • http://getentry.ddbj.nig.ac.jp/getentry/database name/accession number/revision ID/?additional parameters (optional)
(example )
Search by accession number FW383979 by normal GET method
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=FW383979
Search of BD500001( amino acid sequence derived from the Patent ) by smart URL
http://getentry.ddbj.nig.ac.jp/getentry/patent_aa/BD500001

  

Specifiable parameters

getentry

  • accession number(mandatory): Specify the accession number for searching.
  • database(optional): Specify the database for searching.
  • revision(optional): Search for the specified revision.
  • format(optional): Specify the output format for the result.
  • filetype(optional): Specify the filetype for the output.
  • show_suppressed(optional): To display the data for the replaced or suppressed.
  • limit(optional): Sets an upper limit of the data acquisition.


accession number(mandatory): Specify the accession number for searching.

version number
  • If you do not have a version number, you will find the latest version.
  • If you search with a version number, you will find the version specified.
multiple accseeion number
  • You can specify more than one accession number, separated by ",".
  • Output is the same order with the input, which is specified more than one, separated by ",".
  • Range search can be done by connecting the two accession number with "-" .
  • Version number is active
range specification
  • The range search can accept the truncation in the low and high numbers of the range .
  • By separating with ", ", more than one range search can be specified.
  • Version number is ignored.
  • In case of not existing the target result and/or can not be displayed in the screen, no result are displayed in the screen, nor counted in the limit number
  • Please change the number of the entries viewed in the screen if necessay. The default is 10.
Input example (upper:Get method / lower: smart URL)
Search for accession number AB055395
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=AB055395
http://getentry.ddbj.nig.ac.jp/getentry/na/AB055395
Search for Amino acid from patent
http://getentry.ddbj.nig.ac.jp/getentry?database=patent_aa&accession_number=BD500001
http://getentry.ddbj.nig.ac.jp/getentry/patent_aa/BD500001
http://getentry.ddbj.nig.ac.jp/getentry?database=aa&accession_number=DI500001
http://getentry.ddbj.nig.ac.jp/getentry/aa/DI500001
Multiple accseeion numbers search (default:10 entries view)
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=AK388128,AK388131,AK388124,AK388126
http://getentry.ddbj.nig.ac.jp/getentry/na/AK388128,AK388131,AK388124,AK388126
Range search & 1000 entries view
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=FY782000-FY783000&limit=1000
http://getentry.ddbj.nig.ac.jp/getentry/na/FY782000-FYFY783000?limit=1000
Multiple search(combination)
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=AK377101 - AK377200,AK377210,AK377211- AK388100&limit=100
http://getentry.ddbj.nig.ac.jp/getentry/na/AK377101 - AK377200,AK377210,AK377211- AK388100?limit=100
Multiple search(no limit for view)
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=FY782538-FY831121&limit=0
http://getentry.ddbj.nig.ac.jp/getentry/na/FY782538-FY831121?limit=0
Multiple numbers search with Version No,:available
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=AB669632.1,AB669632.2,AB669633.1,AB669633.2,AB669634.1
http://getentry.ddbj.nig.ac.jp/getentry/na/AB669632.1,AB669632.2,AB669633.1,AB66963.2,AB669634.1
Range seach with Version No.:unavailable
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=AB669632.1-AB6696356.1
http://getentry.ddbj.nig.ac.jp/getentry/na/AB669632.1-AB6696356.1

 
 


database(optional): Specify the database for searching.

Default na
DNA na, ddbj, wgs, mga
Protein aa, uniprot, dad, patent_aa, pdb
If you specify na ( default ), DDBJ/EMBL/GenBank (incl. TPA) is searched .
* TPA is not included in the DDBJ release.
In the Protein search, when 'aa' is specified, uniprot, dad, patent_aa, pdb are retrieved in this order.
Input example (upper:Get method / lower: smart URL)
Search for WGS( BAET01000001)
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=BAET01000001
http://getentry.ddbj.nig.ac.jp/getentry/na/BAET01000001
Search for Amino acid from Patent
http://getentry.ddbj.nig.ac.jp/getentry?database=patent_aa&accession_number=DI500001
http://getentry.ddbj.nig.ac.jp/getentry/patent_aa/DI500001
http://getentry.ddbj.nig.ac.jp/getentry?database=aa&accession_number=BD500001
http://getentry.ddbj.nig.ac.jp/getentry/aa/BD500001
DAD search
http://getentry.ddbj.nig.ac.jp/getentry?database=dad&accession_number=AB000714-1
http://getentry.ddbj.nig.ac.jp/getentry/dad/AB000714-1
UniProt search
http://getentry.ddbj.nig.ac.jp/getentry?database=aa&accession_number=P06213
http://getentry.ddbj.nig.ac.jp/getentry/aa/P06213
http://getentry.ddbj.nig.ac.jp/getentry?database=uniprot&accession_number=P06213
http://getentry.ddbj.nig.ac.jp/getentry/uniprot/P06213
Search for MGA( AAAAA0000001)
http://getentry.ddbj.nig.ac.jp/getentry/mga/AAAAA0000001
http://getentry.ddbj.nig.ac.jp/getentry/mga/AAAAA0000001
Search for AB628096 (no database specified)
http://getentry.ddbj.nig.ac.jp/getentry?accession_number=AB628096
http://getentry.ddbj.nig.ac.jp/getentry//AB628096

 
 


revision(optional): Search for the specified revision.

general yyyy-MM-dd hh:mm:ss
release yyyy-MM-dd hh:mm:ss release
When both the version number and revision is specified, revision takes priority.
(Input example (upper:Get method / lower: smart URL)
View of AB479935 at 2011-05-31 23:07:30
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=AB479935&revision=2011-05-31 23:07:30
http://getentry.ddbj.nig.ac.jp/getentry/na/AB479935?revision=2011-05-31 23:07:30
Change history is available by gethistory
http://getentry.ddbj.nig.ac.jp/gethistory?database=na&accession_number=AB479935
http://getentry.ddbj.nig.ac.jp/gethistory/na/AB479935


format(optional): Specify the output format for the result.

Default flatfile
flatfile Output in DDBJ flat file format.
xml Output in INSDSeq-XML version 1.4 format.
fasta [DNA] Total nt seq FASTA
[Protein] Amino acid seq FASTA
trans [DNA] CDS amino acid seq FASTA
cds [DNA] CDS nt seq FASTA
[DAD limited] Nucleotide seq FASTA (for DAD)
Input example (upper:Get method / lower: smart URL)
View AB628096 by flatfile format
http://getentry.ddbj.nig.ac.jp/getentry?accession_number=AB628096
http://getentry.ddbj.nig.ac.jp/getentry//AB628096

LOCUS       AB628096                 390 bp    RNA     linear   VRL 24-FEB-2012
DEFINITION  Human rhinovirus C gene for polyprotein, partial cds, strain:
            HRV/Yamaguchi/2010/89.
ACCESSION   AB628096
VERSION     AB628096.1
KEYWORDS    .
SOURCE      Human rhinovirus C
  ORGANISM  Human rhinovirus C
            Viruses; ssRNA positive-strand viruses, no DNA stage;
            Picornavirales; Picornaviridae; Enterovirus.
REFERENCE   1  (bases 1 to 390)
  AUTHORS   Kobayashi,M., Arakawa,M., Okamoto,R., Tsukagoshi,H., Ryo,A.,
            Mizuta,K., Hasegawa,S., Hirano,R., Wakiguchi,H., Kudo,K.,
            Tanaka,R., Morita,Y., Noda,M., Kozawa,K., Ichiyama,T., Shirabe,K.
            and Kimura,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAY-2011) to the DDBJ/EMBL/GenBank databases.
            Contact:Miho Kobayashi
            Gunma Prefectural Institute of Public Health and Environmental
            Sciences; Kamiokimachi 378, Maebashi, Gunma 371-0052, Japan
REFERENCE   2  
  AUTHORS   Arakawa,M., Okamoto-Nakagawa,R., Toda,S., Tsukagoshi,H.,
            Kobayashi,M., Ryo,A., Mizuta,K., Hasegawa,S., Hirano,R.,
            Wakiguchi,H., Kudo,K., Tanaka,R., Morita,Y., Noda,M., Kozawa,K.,
            Ichiyama,T., Shirabe,K. and Kimura,H.
  TITLE     Molecular epidemiological study of human rhinovirus species A, B
            and C from patients with acute respiratory illnesses in Japan
  JOURNAL   J. Med. Microbiol. 61, 410-419 (2012)
  REMARK    DOI:10.1099/jmm.0.035006-0
COMMENT     
FEATURES             Location/Qualifiers
     source          1..390
                     /collection_date="14-Jan-2010"
                     /country="Japan:Yamaguchi"
                     /db_xref="taxon:463676"
                     /host="Homo sapiens"
                     /isolation_source="Nasopharyngeal swab"
                     /mol_type="genomic RNA"
                     /organism="Human rhinovirus C"
                     /strain="HRV/Yamaguchi/2010/89"
     CDS             1..>390
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAK22546.1"
                     /transl_table=1
                     /translation="MGAQVSKQNVGSHENSVSATGGSVIKYFNINYYKDSASSGLTKQ
                     DFSQDPSKFTQPLAEALTNPALMSPTVEACGMSDRLKQITIGNSTITTQDTLNSILAY
                     GEWPKYLSDLDASSVDKPTHPETSSDRF"
BASE COUNT          124 a           95 c           77 g           94 t
ORIGIN      
        1 atgggcgcac aggtgagcaa gcaaaatgtc ggctcgcacg aaaattcagt ctcagccacg
       61 ggtggatccg tgattaagta tttcaacatc aattactaca aggattctgc tagctctggc
      121 ttgactaaac aagatttttc ccaagaccca tcgaaattca cacaacctct agcagaagca
      181 cttacaaatc cagctttaat gtcaccaact gttgaagcat gtgggatgtc cgataggctt
      241 aaacaaatta ctatcgggaa ttccactata acaacacaag atacactaaa ctctatactg
      301 gcatatgggg agtggcccaa atacttgagt gacctggacg cttcctcagt ggataagcct
      361 acccacccag agacatcatc tgatagattt
//
 
View Amino acie from patent by "Amino acid seq FASTA" format
http://getentry.ddbj.nig.ac.jp/getentry?database=patent_aa&accession_number=BD500001&format=fasta
http://getentry.ddbj.nig.ac.jp/getentry/patent_aa/BD500001?format=fasta
>BD500001|JP 2000316586-A/3: Recombinant microorganism expressing small rubber particle-bound protein (SRPP).
MAEEVEEERLKYLDFVRAAGVYAVDSFSTLYLYAKDISGPLKPGVDTIENVVKTVVTPVY
YIPLEAVKFVDKTVDVSVTSLDGVVPPVIKQVSAQTYSVAQDAPRIVLDVASSVFNTGVQ
EGAKALYANLEPKAEQYAVITWRALNKLPLVPQVANVVVPTAVYFSEKYNDVVRGTTEQG
YRVSSYLPLLPTEKITKVFGDEAS
 
View AB601234 by "Total nt seq FASTA" format
http://getentry.ddbj.nig.ac.jp/getentry?accession_number=AB601234&format=fasta
http://getentry.ddbj.nig.ac.jp/getentry//AB601234?format=fasta
>>AB601234|AB601234.1 Ainsliaea faurieana chs gene for chalcone synthase, partial cds, haplotype: 2.
ggaccttgctaaaaacaataagggctcacatgtccttgttgtctgctctgagatcattgc
ttccatttttcgtagaccagataagaaccacattgtcagccaagctctctttggggatgg
agcttctgcgctcattgtgggttcagacccagacttctccaaggaacatccattattcaa
gattgtgtctacaactcagacaatcttacagaacactgaaagggcgatgaacttacaatt
gagggaagaagggttgaccattcacctgcacagggatgtaccccagatgacatcaaagaa
tatagaggaggcattagtgcacatatttttgccactgggcataagagactggaactcg
 
View AB601234 by "XML format"
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=AB601234&format=xml
http://getentry.ddbj.nig.ac.jp/getentry/na/AB601234/?format=xml
<?xml version="1.0"?>

<!DOCTYPE INSDSet SYSTEM "INSD_INSDSeq.dtd">
-<INSDSet>
 -<INSDSeq> <INSDSeq_locus>AB601234</INSDSeq_locus>
  <INSDSeq_length>358</INSDSeq_length>
   <INSDSeq_moltype>DNA</INSDSeq_moltype>
    <INSDSeq_topology>linear</INSDSeq_topology>
     <INSDSeq_division>PLN</INSDSeq_division>
      <INSDSeq_update-date>18-MAY-2011</INSDSeq_update-date>
       <INSDSeq_definition>Ainsliaea faurieana chs gene for chalcone ......
         <INSDSeq_primary-accession>AB601234</INSDSeq_primary-accession>
         <INSDSeq_accession-version>AB601234.1</INSDSeq_accession-version>
          <INSDSeq_source>Ainsliaea faurieana</INSDSeq_source>
           <INSDSeq_organism>Ainsliaea faurieana</INSDSeq_organism>
            <INSDSeq_taxonomy>Eukaryota; Viridiplantae; Streptophyta; .......
             -<INSDSeq_references>
              -<INSDReference>
              <INSDReference_reference>1</INSDReference_reference>
               <INSDReference_position>1..358</INSDReference_position>
                -<INSDReference_authors> <INSDAuthor>Mitsui,Y.</INSDAuthor>
                 <INSDAuthor>Setoguchi,H.</INSDAuthor> </INSDReference_authors>
                  <INSDReference_title>Direct Submission</INSDReference_title>
                   <INSDReference_journal>Submitted (17-NOV-2010) to the DDBJ/.....
                    -<INSDReference>

                                   -------    ( snip )    -----
View HE963104 by "CDS nt seq FASTA "
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number= HE963104&format=cds
http://getentry.ddbj.nig.ac.jp/getentry/na/HE963104/?format=cds
 >HE963104-1|CCJ27876.1|111|<1..111|Streptococcus thermophilus|predicted.....
gggttgtcctgtgatgagggaatgctggcagtaggaggacttggtgctgtaggtggcccg
tggggagctgtcggtggggtgttagtaggtgcagccttatactgtttctaa

>HE963104-2|CCJ27877.1|201|130..330|Streptococcus thermophilus|hypothetical.....
atgaataataaacaacttgaaagatttaaaaaactggatacaaatgcattgtctaatgta
agtggtcaaggctatggtgctcaatgtgttattggtactgccggaatgacgattgtcggt
gcagctttctttggcatcgcaggtgcaggagctggatttgcaggcggtagcacagcattt
tgttatggtacagctgaataa

>HE963104-3|CCJ27878.1|219|686..>904|Streptococcus thermophilus|.....
atggcaactcaaacaattgaaaactttaacacccttaacctcgaaacacttgctagtgtt
gaaggaggtggatgtggttggagaggcgcaggtggagcgactgttcaaggagctatcggg
ggagcgtttggaggtaatgtagttttaccagttgtaggctcagttcctggttatctagct
ggtggtgttctaggtggtgcaggtggtactgttgcctat
 
Vew search result of PDB byAmino acid seq FASTA
http://getentry.ddbj.nig.ac.jp/getentry?database=pdb&accession_number=0-Z&format=seqres&limit=5
http://getentry.ddbj.nig.ac.jp/getentry/pdb/0-Z/?format=seqres&filetype=html&limit=5
>100d_A mol:na length:10 DNA/RNA (5'-R(*CP*)-D(*CP*GP*GP*CP*GP*CP*CP*G
CCGGCGCCGG
>100d_B mol:na length:10 DNA/RNA (5'-R(*CP*)-D(*CP*GP*GP*CP*GP*CP*CP*G
CCGGCGCCGG
>101d_A mol:na length:12 DNA (5'-D(*CP*GP*CP*GP*AP*AP*TP*TP*(CBR)P*GP*
CGCGAATTCGCG
>101d_B mol:na length:12 DNA (5'-D(*CP*GP*CP*GP*AP*AP*TP*TP*(CBR)P*GP*
CGCGAATTCGCG
>101m_A mol:protein length:154 MYOGLOBIN
---- ( snip ) ----

The nucleotide sequence is displayed in FASTA format
http://getentry.ddbj.nig.ac.jp/getentry/na/FW383979?format=fasta
>FW383979|FW383979.1 JP 2006521812-A/1: GENETIC POLYMORPHISMS ASSOCIATED WITH RHEUMATOID ARTHRITIS, METHODS OF DETECTION AND USES THEREOF.
aagacttcctggaagaggtcccagcgtgagtgtcgcttctggcatctgtccttctggcca
gcctgtggtctggccaagtgatgtaaccctcctctccagcctgtgcacaggcagcctggg
aacagctccatccccacccctcagctataaatagggcmtygtgacccggccrggggaaga
agctgcygttgttctgggtactacagcagaagggtatgcrgaagcsagcaccccagtctg
agatggctcctgccggtgtgagcctgagggccaccatcctctgcctcctggcctgggctg
gcctggctgcaggtgaccgggtgtacatacaccccttccacytcgtcatccacaatgaga
gtaccygtgagyagctggcaaaggccaatgccgggaagcccaaagaccccaccttcatac
ctgctccaattcaggccaagacatcccctgtggatgaaaaggccctacaggaccagctgg
---- ( snip ) ----
PDB by Amino acid seq FASTA
http://getentry.ddbj.nig.ac.jp/getentry/pdb/0-Z/?format=seqres&filetype=html&limit=5
>100d_A mol:na length:10 DNA/RNA (5'-R(*CP*)-D(*CP*GP*GP*CP*GP*CP*CP*G
CCGGCGCCGG
>100d_B mol:na length:10 DNA/RNA (5'-R(*CP*)-D(*CP*GP*GP*CP*GP*CP*CP*G
CCGGCGCCGG
>101d_A mol:na length:12 DNA (5'-D(*CP*GP*CP*GP*AP*AP*TP*TP*(CBR)P*GP*
CGCGAATTCGCG
>101d_B mol:na length:12 DNA (5'-D(*CP*GP*CP*GP*AP*AP*TP*TP*(CBR)P*GP*
CGCGAATTCGCG
>101m_A mol:protein length:154 MYOGLOBIN
---- ( snip ) ----

 
 


filetype(optional): Specify the filetype for the result.

Default text
html HTML file
text Text file
gz gzip format file
gz file name of compressed file will be as follows depending on the value specified format.

[DNA]flatfile
[DNA]xml
[DNA]fasta
[DNA]trans
[DNA]cds
[Protein]flatfile
[Protein]fasta
[Protein]cds
flatfile.txt.gz
insd.xml.gz
fasta_na.txt.gz
cds_aa.txt.gz
cds_na.txt.gz
flatfile.txt.gz
fasta_aa.txt.gz
cds_aa.txt.gz
Input example (upper:Get method / lower: smart URL)
Download AK377185-AK378194 (100 entries) gz compressed format
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=AK377185-AK378194&filetype=gz&limit=1000
http://getentry.ddbj.nig.ac.jp/getentry/ddbj/AK377185-AK378194?filetype=gz&limit=1000

Following is shown on the display

View FW383979 by html format
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=FW383979&filetype=html
http://getentry.ddbj.nig.ac.jp/getentry/na/AB601234/?filetype=html

LOCUS       FW383979                2675 bp    DNA     linear   PAT 14-OCT-2010
DEFINITION  JP 2006521812-A/1: GENETIC POLYMORPHISMS ASSOCIATED WITH RHEUMATOID
            ARTHRITIS, METHODS OF DETECTION AND USES THEREOF.
ACCESSION   FW383979
VERSION     FW383979.1
KEYWORDS    JP 2006521812-A/1.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2675)
  AUTHORS   Alexander,H.C., Bigobikku,A.B. and Kagiru,M.
  TITLE     GENETIC POLYMORPHISMS ASSOCIATED WITH RHEUMATOID
            ARTHRITIS, METHODS 
            OF DETECTION AND USES THEREOF 
  JOURNAL   Patent: JP 2006521812-A 1 28-Sep-2006;
            APLERA CORPORATION
COMMENT     OS   Homo sapiens
            PN   JP 2006521812-A/1
            PD   28-Sep-2006
                               
 

 
 


show_suppressed (optional): To display the suppressed data.

true : display the suppressed data.
false : NOT display the suppressed data.
Input example (upper:Get method / lower: smart URL)
アクセッション番号 HE602933 (suppressed)の検索
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=HE602933&show_suppressed=true
http://getentry.ddbj.nig.ac.jp/getentry/na/HE602933?show_suppressed=true

 
 


limit(optional): Sets an upper limit of the data acquisition.

Default 10
Specify a number less than or equal to 0 unlimited
Input example (upper:Get method / lower: smart URL)
Search for FY736910 - FY762881( 25,972 entries)
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=FY736910 - FY762881&limit=0
http://getentry.ddbj.nig.ac.jp/getentry/na/FY736910 - FY762881?limit=0

It may take a long time to display a large number of results.
According to the performance of the browser, all of that might not be displayed.

 
 

  

gethistory

  • accession number(mandatory): Specify the accession number for searching.
  • database(optional): Specify the database for searching.
  • filetype(optional): Specify the filetype for the result.


accession number(mandatory): Specify the accession number for searching.

Specification method is the same as getentry.

( Input example )
History of accession number AB628096
http://getentry.ddbj.nig.ac.jp/gethistory?database=na&accession_number=AB628096
http://getentry.ddbj.nig.ac.jp/gethistory/na/AB628096
AB628096
1 2012-05-25 12:00:00 release 2012-05-25 12:00:00 release live
1 2012-02-24 07:02:55 2012-02-24 07:02:55 live
1 2011-11-25 11:27:22 release 2011-11-25 11:27:22 release live
1 2011-10-22 23:01:47 2011-10-22 23:01:47 live
1 2011-08-26 10:33:50 release 2011-08-26 10:33:50 release live
1 2011-05-27 12:38:45 release 2011-05-27 12:38:45 release live
1 2011-05-11 23:09:49 2011-05-11 23:09:49 live

History of the amino acid sequence derived from the Patent Office is not available.
 
 


database(optional): Specify the database for searching.

Default na
DNA na

If the specified database does not correspond to the history management, and returns an empty result.

 

 
filetype(optional): Specify the filetype for the result.

Default text
html HTML file
text Text file

  

How to Create Links to DDBJ Entries

You can create links to individual DDBJ entries.

  • http://getentry.ddbj.nig.ac.jp/getentry?database=database name&accession_number=accession number&additional parameters (optional)
  • http://getentry.ddbj.nig.ac.jp/getentry/database name/accession number
  • http://getentry.ddbj.nig.ac.jp/getentry/database name/accession number/?additional parameters (optional)

For example,

a link to AB000001
http://getentry.ddbj.nig.ac.jp/getentry?database=na&accession_number=AB000001
http://getentry.ddbj.nig.ac.jp/getentry/na/AB000001

a link to BD500001, an entry of the amino acid sequence derived from the Patent Office
http://getentry.ddbj.nig.ac.jp/getentry?database=aa&accession_number=BD500001
http://getentry.ddbj.nig.ac.jp/getentry/patent_aa/BD500001

 

As a practical case, please crick the following number to see how the entry can be viewed.

 

Creating links to DRA entries is different from the above method. Please refer to the DRA Web site.

If you build your own website, Please use this method.

ページの先頭へ戻る