What is TSA? – Transcriptome Shotgun Assembly

Since 2008, INSDC (DDBJ/EMBL-Bank/GenBank) has accepted the sequence data of "Transcriptome Shotgun Assembly (TSA)" categorised into TSA division for assembled cDNA sequences.

With new sequencing technologies, INSDC has faced many requests to accept assembled EST sequences. These sequence data have become more useful than used to be, although they may not be correctly assembled or exist in nature. Therefore, DDBJ/EMBL-Bank/GenBank decided to collect assembled EST sequences and classified them into the TSA division.

Note that it is required that the TSA submission with the original sequence data of primary transcripts (primary entries) are classified into the EST division of DDBJ/EMBL-Bank/GenBank, DDBJ Trace Archive or DDBJ Read Archive.

If a primary entry belonged to the submitter who is other than TSA submitter, the TSA entry is classified into TPA category.

You can submit TSA data to DDBJ through Mass Submission System (MSS).

Definition of primary entry for TSA

Primary entries used to build a TSA sequence are mRNA sequences that have been experimentally determined by their submitters and are publicly available on INSDC, Trace Archive, or Sequence Read Archive.

It is possible that primary entries are not yet publicized at the TSA submission. However, the primary entries must be publicized by when the corresponding TSA entry is open to the public.

Notes on the TSA submission

  • Prior to sequence data submission, get a BioProject ID for your project on the BioProject Database
  • Assemblies obtained from multiple species are not acceptable, except Transcriptome Shotgun Assembly derived from environmental sample.
  • The sequences of primary entries used for a TSA assembly are required to be submitted to the EST division of DDBJ/EMBL-Bank/GenBank, DDBJ Trace Archive or DDBJ Read Archive. If you have not yet submitted primary entries of your TSA data, at first, you have to submit them.
  • To describe the correspondence of sequence regions between TSA and primary entries from EST division or DDBJ Trace Archive, both locations should be prepared to describe in PRIMARY line.
    For primary entries from DDBJ Read Archive, cited run accession number is required to describe in DBLINK line.
  • It is strongly recommended to include qualifiers indicating expression conditions; tissue (tissue_type), developmental stage (dev_stage), mating type (mating_type or sex) and so on. However, when the TSA sequence is constructed from two or more different origins, those conditions can not be described.

The sequence alignment rules between TSA and primary entries

  • Regions of a TSA entry can be assembled from a single EST or read so that coverage is only 1x.
  • Limits to ambiguity in the assembled sequence of TSA entry were that;

   [1] the allowable percent of bases that are 'n' should be less than 5% and
   [2] a TSA entry can have a stretch of no more than 5 n' s in a row

Aspects of TSA on DDBJ flat file

LOCUS line provides the division name, "TSA".
"TSA:" is shown at the beginning of DEFINITION line.
"TSA" and "Transcriptome Shotgun Assembly" are indicated in KEYWORDS line.
PRIMARY line provides base spans cited from sequeces of primary entries that contribute to regions of the TSA sequence.

Sample of TSA flat file

LOCUS       FS000000                 800 bp   mRNA     linear   TSA 15-OCT-2008
DEFINITION  TSA: Homo sapiens GAPD gene for glyceraldehyde-3-phosphate
            dehydrogenase, complete cds.
ACCESSION   FS000000
VERSION     FS000000.1
DBLINK      BioProject:PRJDA43210
KEYWORDS    TSA; Transcriptome Shotgun Assembly.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 800)
  AUTHORS   Mishima,H. and Shizuoka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Hanako Mishima
            National Institute of Genetics, DNA Data Bank of Japan; Yata 1111,
            Mishima, Shizuoka 411-8540, Japan
REFERENCE   2  
  AUTHORS   Mishima,H., Shizuoka,T. and Fuji,I.
  TITLE     Glyceraldehyde-3-phosphate dehydrogenase of human
  JOURNAL   TSA Biol 12, 61-70 (2008)
COMMENT  
PRIMARY     TSA_SPAN            PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-599               ZZ000004.1         2-598
            1-669               ZZ000005.1         11-679
            2-596               ZZ000006.1         1-595
            2-575               ZZ000007.1         1-574
            5-676               ZZ000008.1         1-672
            6-725               ZZ000009.1         1-720
            59-369              ZZ000010.1         13-322
            605-800             ZZ000011.1         1-196               c
FEATURES             Location/Qualifiers
     source          1..800
                     /db_xref="taxon:9606"
                     /mol_type="transcribed RNA"
                     /organism="Homo sapiens"
     CDS             73..669
                     /codon_start=1
                     /gene="GAPD"
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="BAA00000.1"
                     /transl_table=1
                     /translation="MWYQSLVIIEKLNLEANIGKLINTKDNINIRCRLSHTEEHSWHS
                     -- The rest of amino acid sequence is omitted -- "
BASE COUNT          199 a          203 c          198 g          200 t
ORIGIN      
        1 attaatataa gctaaatatg tttttcaata tatattgata atagaatatc aacaatttgg
        :
        -- The rest of nucleotide sequence is omitted --
        :
// 
ページの先頭へ戻る