• (May 31 9:00 - 17:00) Announcement of JGA/AGD system suspension

DDBJ Annotated/Assembled Sequences

  • Home
  • Submission
    • Before Submission
    • Web submission
    • Mass Submission
    • Data Update
  • Search
    • getentry
    • ARSA
  • Flat file
    • Feature key
    • Qualifier key
    • Nucleotide Sequences
    • Organism qualifier
    • Identifiers
    • Description of Location
    • Protein Coding Sequence
    • The Genetic Codes
    • Codes Used in Sequence Description
    • Example of Submission
  • Data categories
    • Data Submission from Genome Project
    • Pseudohaplotype
    • WGS
    • Finished level genomic sequences
    • Metagenome Assembly
    • Single amplified genome
    • CON
    • GSS
    • HTG
    • Submission of environmental sequences
    • ENV
    • TLS
    • Data Submission from Transcriptome Project
    • TSA
    • EST
    • HTC
    • Third Party Data (TPA)
  • FAQ
  • Other
    • Patent
    • MGA
  • Home
  • ddbj
  • Example of Submission

Example of Submission

Example of Submission

Please refer to following sample data list to annotate your sequences for DDBJ submission.

A: Ribosomal RNA, ITS, IGS

A01) 16S rRNA gene

DEFINITION  Vibrio halioticoli IAM 14597 gene for 16S rRNA, partial sequence.
FEATURES             Location/Qualifiers
     source          1..1471
                     /mol_type="genomic DNA"
                     /organism="Vibrio halioticoli"
                     /strain="IAM 14597" 
     rRNA            <1..>1471
                     /product="16S ribosomal RNA" 

A02) 18S rRNA gene including intron

DEFINITION  Sporobolomyces ruber JCM 6884 gene for 18S rRNA, partial sequence. 
FEATURES             Location/Qualifiers
     source          1..2072
                     /mol_type="genomic DNA"
                     /organism="Sporobolomyces ruber"
                     /strain="JCM 6884" 
     rRNA            join(<1..1144,1469..>2072)
                     /product="18S ribosomal RNA" 
     intron          1145..1468

A03) ITS1, ITS2

DEFINITION  Microsphaera trifolii var. trifolii MUMH29s genes for 18S rRNA, 
            ITS1, 5.8S rRNA, ITS2, 28S rRNA, partial and complete sequence.
FEATURES             Location/Qualifiers
     source          1..597
                     /isolate="MUMH29s"
                     /mol_type="genomic DNA"
                     /organism="Microsphaera trifolii var. trifolii"
                     /host="Trifolium vulgaris"
                     /tissue_type="conidia"
                     /variety="trifolii" 
     rRNA            <1..4
                     /product="18S ribosomal RNA" 
     misc_RNA        5..224
                     /note="internal transcribed spacer 1" 
     rRNA            225..378
                     /product="5.8S ribosomal RNA" 
     misc_RNA        379..562
                     /note="internal transcribed spacer 2" 
     rRNA            563..>597
                     /product="28S ribosomal RNA" 

If each feature (rRNA, ITS) location is not clear, following annotation can be described.

FEATURES             Location/Qualifiers
     source          1..597
                     /isolate="MUMH29s"
                     /mol_type="genomic DNA"
                     /organism="Microsphaera trifolii var. trifo lii"
                     /host="Trifolium vulgaris"
                     /tissue_type="conidia"
                     /variety="trifolii" 
     misc_RNA        <1..>597
                     /note="contains 18S ribosomal RNA, internal transcribed
                     spacer 1, 5.8S ribosomal RNA, internal transcribed spacer
                     2, and 28S ribosomal RNA"

A04) intergenic spacer, IGS

DEFINITION  Setaria italica cv. Shimokatsugi genes for 25S rRNA, IGS, 17S rRNA, 
            partial and complete sequence.
FEATURES             Location/Qualifiers
     source          1..2646
                     /clone="pSIR012"
                     /country="Japan"
                     /cultivar="Shimokatsugi"
                     /mol_type="genomic DNA"
                     /organism="Setaria italica" 
     rRNA            <1..493
                     /product="25S ribosomal RNA" 
     misc_feature    494..2484
                     /note="intergenic spacer, IGS" 
     rRNA            2485..>2646
                     /product="17S ribosomal RNA" 

B: Protein-coding genes

B01) CDS (mRNA)

DEFINITION  Homo sapiens AQP9 mRNA for aquaporin 9, complete cds. 
FEATURES             Location/Qualifiers
     source          1..2878
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
                     /tissue_type="liver" 
     CDS             217..1104
                     /codon_start=1
                     /gene="AQP9"
                     /product="aquaporin 9"
                     /translation="--- omitted ---"
                     /transl_table=1 

B02) CDS (DNA)

DEFINITION  Aspergillus oryzae RIB128 tglA gene for triacylglycerol lipase, 
            complete cds.
FEATURES             Location/Qualifiers
     source          1..1025
                     /mol_type="genomic DNA"
                     /organism="Aspergillus oryzae"
                     /strain="RIB128" 
     CDS             join(34..330,378..523,607..764,827..990)
                     /codon_start=1
                     /gene="tglA"
                     /product="triacylglycerol lipase"
                     /transl_table=1
                     /translation="--- omitted ---" 

B03) premature mRNA

DEFINITION  Cynops pyrrhogaster CpTbx3 premature mRNA, partial cds.
FEATURES             Location/Qualifiers
     source          1..5170
                     /dev_stage="gastrula"
                     /mol_type="transcribed RNA"
                     /organism="Cynops pyrrhogaster"
                     /tissue_type="embryo" 
     intron          <1..359
     CDS             <360..2135
                     /codon_start=1
                     /gene="CpTbx3"
                     /note="T-box family member; T-box domain"
                     /transl_table=1
                     /translation="--- omitted ---" 

B04) promoter region

DEFINITION  Mus musculus 129SVJ mNB-3 gene for neural recognition molecule NB-3,
            exon 1 and promoter region.
FEATURES             Location/Qualifiers
     source          1..1300
                     /dev_stage="4-8 weeks old"
                     /mol_type="genomic DNA"
                     /organism="Mus musculus"
                     /sex="female"
                     /strain="129SVJ" 
     regulatory      <1..1197
                     /regulatory_class="promoter"
     exon            1198..>1300
                     /gene="mNB-3"
                     /note="neural recognition molecule NB-3"
                     /number=1

B05) 5’ flanking region

DEFINITION  Mus musculus 129SV gene for membrane cofactor protein CD46, 5' 
            flanking region.
FEATURES             Location/Qualifiers
     source          1..1614
                     /mol_type="genomic DNA"
                     /organism="Mus musculus"
                     /strain="129SV" 
     misc_feature    1..1614
                     /note="5' flanking region"
                     /product="membrane cofactor protein CD46" 

B06) pseudogene

DEFINITION  Homo sapiens pseudogene, necdin. 
FEATURES             Location/Qualifiers
     source          1..2285
                     /mol_type="genomic DNA"
                     /organism="Homo sapiens" 
     CDS             <1..1319
                     /note="pseudogene of necdin"
                     /pseudogene="processed" 

B07) alternative splicing (mRNA)

[isoform 1]
DEFINITION  Homo sapiens BAP2 mRNA for BAI-associated protein 2 alpha, 
            complete cds. 
ACCESSION   XA000001 
FEATURES             Location/Qualifiers
     source          1..3168
                     /mol_type="mRNA"
                     /organism="Homo sapiens" 
     CDS             94..1659
                     /codon_start=1
                     /gene="BAP2"
                     /note="alternative splicing: see also Acc# XA000002.1"
                     /product="BAI-associated protein 2 alpha"
                     /transl_table=1
                     /translation="--- omitted ---" 

[isoform 2]
DEFINITION  Homo sapiens BAP2 mRNA for BAI-associated protein 2 beta, 
            complete cds. 
ACCESSION   XA000002 
FEATURES             Location/Qualifiers
     source          1..2129
                     /mol_type="mRNA"
                     /organism="Homo sapiens" 
     CDS             94..1659
                     /codon_start=1
                     /gene="BAP2"
                     /note="alternative splicing: see also Acc# XA000001.1"
                     /product="BAI-associated protein 2 beta"
                     /transl_table=1
                     /translation="--- omitted ---" 

B08) alternative splicing (DNA)

DEFINITION  Homo sapiens KNP-I gene for KNP-I alpha protein, KNP-I beta
            protein, partial cds, alternative splicing. 
FEATURES             Location/Qualifiers
     source          1..13051
                     /cell_line="GM130B"
                     /cell_type="B-lymphoblastoid"
                     /chromosome="21"
                     /clone="D6B5"
                     /map="21q22.3"
                     /mol_type="genomic DNA"
                     /organism="Homo sapiens" 
     exon            2676..2884
                     /gene="KNP-I"
                     /number=1 
     CDS             join(2744..2884,3148..3200,5106..5219,6223..6342,9296..
                     9388,12251..>12407)
                     /codon_start=1
                     /gene="KNP-I"
                     /product="KNP-I alpha protein"
                     /translation="--- omitted ---" 
     CDS             join(2744..2884,3148..3200,5106..5219,6223..6342,12251..
                     >12407)
                     /codon_start=1
                     /gene="KNP-I"
                     /note="alternative splicing"
                     /product="KNP-I beta protein"
                     /translation="--- omitted ---" 
     exon            3148..3200
                     /gene="KNP-I"
                     /number=2
     exon            5106..5219
                     /gene="KNP-I"
                     /number=3
     exon            6223..6342
                     /gene="KNP-I"
                     /number=4
     exon            9296..9388
                     /gene="KNP-I"
                     /number=5 
     exon            12251..12407
                     /gene="KNP-I"
                     /number=6 

B09) RNA editing

DEFINITION  Beta vulgaris TK81-O mitochondrial nad4L gene for NADH 
            dehydrogenase subunit 4L, complete cds.
FEATURES             Location/Qualifiers
     source          1..400
                     /mol_type="genomic DNA"
                     /organelle="mitochondrion"
                     /organism="Beta vulgaris"
                     /strain="TK81-O" 
     CDS             71..373
                     /codon_start=1
                     /exception="RNA editing"
                     /gene="nad4L"
                     /note="initiation codon is created by RNA editing"
                     /product="NADH dehydrogenase subunit 4L"
                     /transl_table=1
                     /translation="--- omitted ---" 
     misc_feature    72
                     /note="C to U RNA editing" 
     misc_feature    117
                     /note="C to U RNA editing" 
     misc_feature    125
                     /note="C to U RNA editing" 
     misc_feature    180
                     /note="C to U RNA editing" 
     misc_feature    201
                     /note="C to U RNA editing" 

B10) ribosomal frameshift in HIV1 complete genome

DEFINITION  Human immunodeficiency virus 1 95TNIH047 proviral DNA, complete 
            genome.
FEATURES             Location/Qualifiers
     source          1..9430
                     /country="Japan"
                     /isolate="95TNIH047"
                     /isolation_source="peripheral blood mononuclear 
                     cell of male patient"
                     /mol_type="genomic DNA"
                     /organism="Human immunodeficiency virus 1"
                     /proviral
     CDS             join(759..2049,2049..5059)
                     /codon_start=1
                     /gene="gag-pol"
                     /note="produced by ribosomal frameshift slip on tttttt 
                     slippery site"
                     /product="gag-pol fusion polyprotein"
                     /ribosomal_slippage
                     /translation="--- omitted ---"  
     CDS             759..2255
                     /codon_start=1
                     /gene="gag"
                     /product="Gag polyprotein precursor"
                     /transl_table=1
                     /translation="--- omitted ---"
     --- The rest is omitted --- 

B11) partial TAA stop codon in mitochondrial genome

DEFINITION  Mus musculus SAMP8 mitochondrial DNA, complete genome. 
FEATURES             Location/Qualifiers
     source          1..16299
                     /mol_type="genomic DNA"
                     /organelle="mitochondrion"
                     /organism="Mus musculus"
                     /strain="SAMP8"
                     /tissue_type="liver"
     --- omitted --- 
     CDS             8607..9390
                     /codon_start=1
                     /gene="COX3"
                     /note="TAA stop codon is completed by the addition of 3' 
                     A residues to the mRNA"
                     /product="cytochrome oxidase subunit 3"
                     /transl_except=(pos:9390,aa:TERM)
                     /transl_table=2
                     /translation="--- omitted ---" 
     tRNA            9391..9458
                     /anticodon=(pos:9421..9423,aa:Gly,seq:tcc)
                     /note="codon recognized: GGA"
                     /product="tRNA-Gly" 
     CDS             9459..9806
                     /codon_start=1
                     /gene="ND3"
                     /product="NADH dehydrogenase subunit 3"
                     /transl_table=2
                     /translation="--- omitted ---" 
     tRNA            9808..9875
                     /anticodon=(pos:9838..9840,aa:Arg,seq:tcg)
                     /note="codon recognized: CGA"
                     /product="tRNA-Arg"
  --- The rest is omitted --- 

B12) Major Histocompatibility Complex (MHC)

DEFINITION  Homo sapiens HLA-A gene for MHC class I antigen, partial cds,
            allele: HLA-A2(A*0201V3). 
FEATURES             Location/Qualifiers
     source          1..546
                     /mol_type="genomic DNA"
                     /note="HLA-A2(A*0201V3)/24,B35/60,DRB1*1501/1202"
                     /organism="Homo sapiens" 
     CDS             <1..>546
                     /allele="HLA-A2(A*0201V3)"
                     /codon_start=3
                     /gene="HLA-A"
                     /product="MHC class I antigen"
                     /transl_table=1
                     /translation="--- omitted ---" 

B13) trans_splicing

DEFINITION  Psilotum nudum Kingyoku chloroplast DNA, complete genome.
FEATURES             Location/Qualifiers
     source          1..138829
                     /cultivar="Kingyoku"
                     /mol_type="genomic DNA"
                     /organelle="plastid:chloroplast"
                     /organism="Psilotum nudum"
     ---- omitted ----
     CDS             join(complement(68922..69035),133880..134137)
                     /codon_start=1
                     /note="trans splicing of 5'rps12 exon and 3'rps12 exon"
                     /product="ribosomal protein S12"
                     /protein_id="BAB84240.1"
                     /trans_splicing
                     /transl_table=11
                     /translation="MPTIQQLIRNARQPIRSRTKSPALRG CPQRRGVCIRVYTTTPK
                     KPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVSVRGGRVKDLPGVRYHIVRGT
                     LDAVGVKDRKQGRSRYGVKKPK" 
     exon            complement(68922..69035)
                     /gene="rps12"
                     /note="5'rps12 exon, trans splicing"
                     /number=1
                     /product="ribosomal protein S12"
     ---- omitted ----
     exon            133880..134137
                     /gene="rps12"
                     /note="3'rps12 exon, trans splicing"
                     /number=2
                     /product="ribosomal protein S12"
                     ---- omitted ---- 

B14) preproprotein

DEFINITION  Homo sapiens NMS mRNA for prepro-neuromedin S, complete cds.
FEATURES             Location/Qualifiers
     source          1..485
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
     CDS             8..469
                     /codon_start=1
                     /gene="NMS"
                     /product="prepro-neuromedin S"
                     /transl_table=1
                     /translation="--- omitted ---"
     sig_peptide     8..88
                     /gene="NMS"
     propeptide      89..466
                     /gene="NMS"
                     /product="pro-neuromedin S"
     mat_peptide     332..430
                     /gene="NMS"
                     /product="neuromedin S"

B15) polyprotein

DEFINITION  Dengue virus 2 DR123 genomic RNA, complete genome.
FEATURES             Location/Qualifiers
     source          1..10723
                     /collection_date="2001"
                     /country="Dominican Republic"
                     /host="Homo sapiens"
                     /mol_type="genomic RNA"
                     /organism="Dengue virus 2"
                     /strain="DR123"
     CDS             97..10272
                     /codon_start=1
                     /product="polyprotein"
                     /transl_table=1
                     /translation="--- omitted ---"
     mat_peptide     97..438
                     /product="anchored capsid protein C"
     mat_peptide     439..936
                     /product="membrane glycoprotein precursor M"
     mat_peptide     937..2421
                     /product="envelope protein E"
     mat_peptide     2422..3477
                     /product="nonstructural protein NS1"
     mat_peptide     3478..4131
                     /product="nonstructural protein NS2A"
     mat_peptide     4132..4518
                     /product="nonstructural protein NS2B"
     mat_peptide     4519..6375
                     /product="nonstructural protein NS3"
     mat_peptide     6376..6825
                     /product="nonstructural protein NS4A"
     mat_peptide     6826..7569
                     /product="nonstructural protein NS4B"
     mat_peptide     7570..10269
                     /product="RNA-dependent RNA polymerase"

C: EST, GSS, STS

C01) EST (Expressed Sequence Tag)

See also EST division.

DEFINITION  Mus musculus cDNA, clone: 2310009B01, 3' end sequence, expressed
            in tongue. 
KEYWORDS    EST; 3'-end sequence (3'-EST).
FEATURES             Location/Qualifiers
     source          1..267
                     /clone="2310009B01"
                     /clone_lib="RIKEN full-length enriched mouse tongue cDNA 
                     library A502"
                     /dev_stage="adult"
                     /mol_type="mRNA"
                     /organism="Mus musculus"
                     /sex="male"
                     /tissue_type="tongue" 

C02) GSS (Genome Survey Sequence)

See also GSS division.

DEFINITION  Arabidopsis thaliana Columbia DNA, YAC clone: CIC5D1, left end,
            chromosome 1 between mi303 and mi259.
KEYWORDS    GSS.
FEATURES             Location/Qualifiers
     source          1..532
                     /chromosome="1"
                     /clone="YAC clone CIC5D1"
                     /map="between mi303 and mi259"
                     /mol_type="genomic DNA"
                     /organism="Arabidopsis thaliana"
                     /ecotype="Columbia" 

C03) STS (Sequence Tagged Site)

DEFINITION  Sus scrofa DNA, STS on chromosome 1, clone:AA12345, 
            sequence tagged site. 
KEYWORDS    STS.
FEATURES             Location/Qualifiers
     source          1..200
                     /chromosome="1"
                     /clone="AA12345"
                     /mol_type="genomic DNA"
                     /organism="Sus scrofa"
     primer_bind     1..20
                     /PCR_conditions="30 cycles 94degC 30 sec, 
                     56degC 30 sec and 72degC 30 sec" 
     primer_bind     complement(180..200)

D: Repeat

D01.1) microsatellite, recommended annotation

DEFINITION  Bos taurus DNA, microsatellite: 3456P. 
FEATURES             Location/Qualifiers
     source          1..300
                     /chromosome="11"
                     /map="11p"
                     /mol_type="genomic DNA"
                     /organism="Bos taurus" 
     primer_bind     20..40
                     /PCR_conditions="denaturation 94degC 2 min; 30 cycles
                     94degC 30 sec, 56degC 1 min, 72degC 1 min; final
                     extention 72degC 1 min" 
     repeat_region   60..200
                     /rpt_type=tandem
                     /rpt_unit_seq="ta" 
                     /satellite="microsatellite: 3456P"
     primer_bind     complement(210..230)

D01.2) microsatellite, minimal annotation

DEFINITION  Paralichthys olivaceus DNA, microsatellite: Poli1TUF.
FEATURES             Location/Qualifiers
     source          1..222
                     /mol_type="genomic DNA"
                     /organism="Paralichthys olivaceus" 
     repeat_region   25..94
                     /rpt_type=tandem
                     /rpt_unit_seq="ca"
                     /satellite="microsatellite: Poli1TUF"

D02) transposon

DEFINITION  Escherichia coli transposon Tn2000 DNA, complete sequence. 
FEATURES             Location/Qualifiers
     source          1..5000
                     /mol_type="genomic DNA"
                     /organism="Escherichia coli" 
     mobile_element  1..5000
                     /mobile_element_type="transposon:Tn2000" 
     repeat_region   1..100
                     /rpt_type=inverted 
     CDS             146..1576
                     /codon_start=1
                     /product="transposase"
                     /transl_table=11
                     /translation="--- omitted ---" 
     CDS             2785..3585
                     /codon_start=1
                     /product="streptomycin phosphotransferase"
                     /transl_table=11
                     /translation="--- omitted ---" 
     repeat_region   4900..5000
                     /rpt_type=inverted 

D03) insertion sequence

DEFINITION  Streptomyces coelicolor A456 insertion sequence IS123 DNA, complete 
            sequence.
FEATURES             Location/Qualifiers
     source          1..2000
                     /mol_type="genomic DNA"
                     /organism="Streptomyces coelicolor"
                     /strain="A456" 
     repeat_region   44..48
                     /note=target sequence
                     /rpt_type=flanking 
     mobile_element  49..1166
                     /mobile_element_type="insertion sequence:IS123" 
     repeat_region   49..78
                     /note="30nt perfect inverted repeat"
                     /rpt_type=inverted 
     CDS             271..1110
                     /codon_start=1
                     /gene="tnpA"
                     /product="transposase"
                     /transl_table=11
                     /translation="--- omitted ---" 
     repeat_region   1137..1166
                     /note="30nt perfect inverted repeat"
                     /rpt_type=inverted 
     repeat_region   1167..1171
                     /note="target sequence"
                     /rpt_type=flanking 

E: Particular resources

E01) environmental sample sequence

See also environmental samples.

DEFINITION  Uncultured bacterium 4-11 gene for 16S rRNA, partial sequence.
FEATURES             Location/Qualifiers
     source          1..1475
                     /clone="4-11"
                     /environmental_sample
                     /isolation_source="solid waste compost"
                     /mol_type="genomic DNA"
                     /organism="uncultured bacterium" 
     rRNA            <1..>1475
                     /product="16S rRNA" 

E02) organism name with sp. (unidentified species)

DEFINITION  Eirene sp. EML1 GAPDH mRNA for glyceraldehyde-3-phosphate 
            dehydrogenase, partial cds. 
FEATURES             Location/Qualifiers
     source          1..245
                     /mol_type="mRNA"
                     /organism="Eirene sp. EML1"
                     /strain="EML1" 
     CDS             <1..>245
                     /codon_start=3
                     /gene="GAPDH"
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /translation="--- omitted ---" 

E03) natural plasmid

DEFINITION  Rhodococcus rhodochrous IFO 3338 plasmid pRC4 repA, repB genes for 
            replication protein, DNA-binding replication protein, complete 
            cds.
FEATURES             Location/Qualifiers
     source          1..2582
                     /mol_type="genomic DNA"
                     /organism="Rhodococcus rhodochrous"
                     /plasmid="pRC4"
                     /strain="IFO 3338" 
     CDS             1142..2062
                     /codon_start=1
                     /gene="repA"
                     /product="replication protein"
                     /transl_table=11
                     /translation="--- omitted ---" 
     CDS             2052..2333
                     /codon_start=1
                     /gene="repB"
                     /product="DNA-binding replication protein"
                     /transl_table=11
                     /translation="--- omitted ---" 

E04) cloning vector

DEFINITION  Cloning vector pAP3neo DNA, complete sequence. 
FEATURES             Location/Qualifiers
     source          1..5350
                     /mol_type="other DNA"
                     /organism="Cloning vector pAP3neo" 
     rep_origin      572..1452
                     /note="ColE1-derived plasmid replication origin" 
     CDS             complement(1513..2373)
                     /codon_start=1
                     /gene="Amp"
                     /product="beta-lactamase"
                     /transl_table=11
                     /translation="--- omitted ---" 
     rep_origin      2504..2959
                     /note="phage f1 region" 
     regulatory      3290..3485
                     /note="SV40 early promoter"
                     /regulatory_class="promoter"
     CDS             3596..4390
                     /codon_start=1
                     /gene="neo"
                     /product="neomycin phosphotransferase"
                     /transl_table=11
                     /translation="--- omitted ---" 
     regulatory      4788..4983
                     /note="SV40 early promoter" 
                     /regulatory_class="promoter"
     regulatory      5188..5207
                     /note="T7 promoter" 
                     /regulatory_class="promoter"
     regulatory      5302..5321
                     /note="T3 promoter" 
                     /regulatory_class="promoter"

E05) synthetic construct

DEFINITION  Synthetic construct gene for Rai-chu 101, complete cds. 
FEATURES             Location/Qualifiers
     source          1..2223
                     /focus
                     /mol_type="other DNA"
                     /organism="synthetic construct" 
     CDS             1..2223
                     /codon_start=1
                     /gene="Rai-chu 101"
                     /note="fusion protein, Ras and interacting protein 
                     chimeric unit 101"
                     /product="Rai-chu 101"
                     /transl_table=11
                     /translation="--- omitted ---" 
     source          724..1239
                     /mol_type=other DNA""
                     /note="derived from human H-Ras cDNA"
                     /organism="Homo sapiens" 
     source          1258..1500
                     /mol_type=other DNA""
                     /note="derived from human Raf cDNA"
                     /organism="Homo sapiens" 

E06.1) miRNA mature transcript

DEFINITION  Arabidopsis thaliana miR840 miRNA.
FEATURES             Location/Qualifiers
     source          1..21
                     /mol_type="transcribed RNA"
                     /organism="Arabidopsis thaliana"
     ncRNA           1..21
                     /ncRNA_class="miRNA"
                     /product="miR840"

E06.2) miRNA precursor transcript

DEFINITION  Arabidopsis thaliana miR840-843 polycistronic noncoding RNA.
FEATURES             Location/Qualifiers
     source          1..2223
                     /mol_type="transcribed RNA"
                     /organism="Arabidopsis thaliana"
     precursor_RNA   1..1342
                     /product="miR840-843 polycistronic noncoding RNA"
     ncRNA           98..119
                     /ncRNA_class="miRNA"
                     /product="miR840"
     ncRNA           1177..1197
                     /ncRNA_class="miRNA"
                     /product="miR843" 

F: Variation

F01) polymorphism and variation

See also representative submissions of identical sequences for variation studies.

DEFINITION  Homo sapiens IGF1R mRNA for insulin-like growth factor I receptor,
            partial cds. 
FEATURES             Location/Qualifiers
     source          1..1000
                     /mol_type="mRNA"
                     /organism="Homo sapiens" 
     CDS             <1..>1000
                     /codon_start=2
                     /gene="IGF1R"
                     /product="insulin-like growth factor I recep tor"
                     /translation="--- omitted ---" 
     variation       100
                     /inference="similar to DNA sequence (same 
                     species):INSD:AB000000.1"
                     /note="polymorphism"
                     /note="This substitution causes an amino acid 
                     substitution from Ala to Thr."
                     /replace="a" 

F02) candidates of polymorphism found by direct sequencing of diploid genome


FEATURES             Location/Qualifiers
     source          1..426
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
     variation       260
                     /experiment="heterozygous SNP detection from direct
                     sequencing"
                     /note="putative SNP, T/C"
     variation       342
                     /experiment="heterozygous SNP detection from direct
                     sequencing"
                     /note="putative SNP, T/C"
BASE COUNT          164 a           55 c           55 g          150 t
ORIGIN      
        1 gagccacatc aagatcacca tatttcagcg gatcatcagc tttctcccct actatagtat
       61 cctcagataa agagaccatt gagattatag acctagctaa gaaagattta gagaagctga
      121 aaagaaaaga aaagaagaag aaaaaaaggt agtgttataa aatcactttt atatgaatct
      181 ctattcttct cacttttaag gatattttaa tttgcagttg caatgagtat atataacctc
      241 atttttaaaa atgaaatgty atttaacata gattataatt atatattttt aaagatttat
      301 ctcttcctta tatgtaaaaa attaaattaa ttacaataat ayggtagtga attttattta
      361 gactatgata aggtaaaatt actattagaa attattttat tatttcttca actagctgcc
      421 tttgca
//

G: Sequencing gap

G01) entry with unknown gaps

DEFINITION  Homo sapiens HLA-A gene for MHC class I antigen, partial cds,
            allele: HLA-A*2601V1.
FEATURES             Location/Qualifiers
     source          1..1022
                     /mol_type="genomic DNA"
                     /note="HLA-A*2601V1/2402,B*4001/4002,DRB1*0901/1401,
                     TBC191371"
                     /organism="Homo sapiens" 
     CDS             join(<1..270,371..646,747..>1022)
                     /allele="HLA-A*2601V1"
                     /codon_start=3
                     /gene="HLA-A"
                     /product="MHC class I antigen"
                     /translation="--- omitted ---" 
     exon            1..270
                     /allele="HLA-A*2601V1"
                     /gene="HLA-A"
                     /number=2 
     gap             271..370
                     /estimated_length=unknown
     exon            371..646
                     /allele="HLA-A*2601V1"
                     /gene="HLA-A"
                     /number=3 
     gap             647..746
                     /estimated_length=unknown
     exon            747..1022
                     /allele="HLA-A*2601V1"
                     /gene="HLA-A"
                     /number=4 
BASE COUNT          166 a          249 c          288 g           119 t
ORIGIN
        1 gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc 
       61 gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg 
      121 cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg 
      181 accggaacac acggaatgtg aaggcccact cacagactga ccgagcgaac ctggggaccc 
      241 tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 
      301 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 
      361 nnnnnnnnnn gttctcacac cgtccagagg atgtatggct gcgacgtggg gccggacggg 
      421 cgcttcctcc gcgggtacca gcaggacgct tacgacggca aggattacat cgccctgaac 
      481 gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg 
      541 gagacggccc atgaggcgga gcagtggaga gcctacctgg agggccggtg cgtggagtgg 
      601 ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn 
      661 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 
      721 nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaagacg catatgactc accacgctgt 
      781 ctctgaccat gaggccaccc tgaggtgctg ggccctgagc ttctaccctg cggagatcac 
      841 actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag 
      901 gcctgcaggg gatgggacct tccagaagtg ggcgtctgtg gtggtgcctt ctggacagga 
      961 gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca ccctgagatg 
     1021 gg
//

Related pages

  • DDBJ flat file format
  • Feature Key
  • Qualifier key
  • Organism qualifier
  • Description of Location
  • Protein Coding Sequence; CDS feature
  • The Genetic Codes
  • Codes Used in Sequence Description