DDBJ Annotated/Assembled Sequences
TPA
Regarding TPA data, DDBJ currently accepts only TPA:assembly.
Starting in January 2025, new submissions of the types TPA:experimental and TPA:inferential were no longer accepted (announcement).
TPA (Third Party Data) is a collection of nucleotide sequence data that has been assembled or (re) annotated by a third party (TPA submitters) based on entries already registered in INSDC (called primary entries). Those assemblies include two cases; one or more primary entries are used and newly determined sequence is contained. TPA sequence data should be submitted to INSDC databases (DDBJ/ENA/GenBank) as a part of the process to publish biological research for primary nucleotide sequences.
Reference Literature: Cochrane,G. et al. (2006) OMICS,10(2): 105-113
Definition of primary entry for TPA
Primary entries used to build a TPA sequence are those that have been experimentally determined and are publicly available in the INSD databases.
Each primary entry must be identified in the TPA entry.
Primary entries are sometimes not yet publicized at the submission of TPA sequence.However, the primary entries must be publicized when TPA sequence is opened to the public.
Acceptable TPA sequence data
In order to draw a distinction between annotation supported by wet-lab. experimental evidence and inferred annotation, the TPA dataset is divided into TPA:experimental and TPA:inferential.
Please refer to the detailed list of TPA rule.
| TPA:experimental | describes records that include functional annotation derived at least in part from peer-reviewed wet-lab experimental investigation. |
| TPA:inferential | describes records that include functional annotation derived from peer-reviewed bioinformatic investigation. |
| TPA:assembly | describes records reporting assembly or reassembly, for which the generation, whether it is purely informatic or informed by experimentation, has been subject to peer review. Annotation may or may not be available and does not require to be part of the peer review for this TPA class. |
| TPA:specialist_db | describes records whose sequences are submitted from an existing authoritative public database that is built using INSDC sequence data and is described in an accepted peer-reviewed publication. The existing database is therefore recognized to be comprehensive, to have added value, and to be maintained long term. |
[Note]Until 2005, the only entries which were supported by biological (wet-lab.) experiment were accepted in TPA. Since 2006, entries which are not supported by wet-lab. experiment have been included into TPA when the entry meets the requirements of TPA Submission Guidelines.
Refer also Unacceptable records for TP
The following cases are NOT acceptable in TPA
- Consensus sequences obtained from multiple species are not acceptable.
- Annotation of repeat (and no other) features.
- Annotation that has arisen from an automated tool, such as GeneMark,tRNA scan or ORF finder, where no further evidence, experimental or otherwise, is presented for the annotation.
The annotation in these cases has not been the subject of the peer review of the publication. - A record representing a completely sequenced genome including only features that have not been assigned gene symbols or product identifiers, for which none has wet laboratory experimental evidence.
Notes on the TPA submission
- TPA data can be submitted through Mass Submission System (MSS) . Please visit the MSS form site to complete the TPA submission.
- The accession numbers of primary entries used to assemble a TPA sequence must be cited for TPA submission.
- The sequences of primary entries used to assemble a TPA sequence are required to be submitted to INSDC as ‘primary data (i.e. not TPA)’ or Trace Archive. If your TPA sequence contains a region that can not be obtained from INSDC or Trace Archive, but has been experimentally determined by yourself, at first, you have to submit it to DDBJ or Trace Archive.
- For publicizing of TPA sequence, the evidence which support the sequence or annotation must be shown in a paper of a peer-reviewed journal.
- To describe the correspondence of sequence regions between TPA and primary entries, both locations should be prepared.
- In the case of whole scale genome assembly (e.g. TPA-WGS; Third Party Data-Whole Genome Shotgun) submission, it is mandatory to register both registration of a project to the BioProject and a bioresource to the BioSample databases respectively, prior to the TPA data submission. If you wish to annotate all protein-coding genes and non-protein-coding RNA genes on the assembly sequences, please register a locus_tag prefix when submitting each BioSample.
- Sample annotation: TPA-WGS annotation
The sequence alignment rule between TPA and primary entries
- The accession number of the primary entries should describe on the COMMENT line or in a PRIMARY block. For COMMENT lines, list the accession numbers (with/without addiotional information) can be described. For PRIMARY block, you can describe the details of the correspondence of sequence regions between TPA and primary entries such as location of the sequences.
- There cannot be stretches of more than 50bp which are unaccounted for by any contributing entry.
- A TPA sequence may not differ from the primary sequence(s) used to build/assemble it and any unmatched sections by greater than 5%. (This includes the overall length and individual primary accession)
- This 5% (or less) difference will include sections of TPA sequence not covered by any primary, and it will include any differences between the TPA sequence and the primaries used, such as insertions, deletions, and substitutions.
- These rules are based on length and similarity.
Aspects of TPA on DDBJ flat file
- LOCUS line represents the taxonomic division except CON and TSA cases.
- Either of “TPA_exp:” (for TPA:experimental) or “TPA_inf:” (for TPA:inferential) is shown at the beginning of DEFINITION line.
- Either set of the following values is indicated in KEYWORDS line.
forTPA:experimental Third Party Data; TPA; TPA:experimental. for TPA:inferential Third Party Data; TPA; TPA:inferential. for TPA:assembly Third Party Data; TPA; TPA:assembly. for TPA:specialist_db Third Party Data; TPA; TPA:specialist_db. - PRIMARY block provides base spans cited from sequeces of primary entries that contribute to regions of the TPA sequence.
Sample of TPA flat file
- Example of non-TPA-assembly
- Basically, a TPA entry submitted to DDBJ is assigned an accession number that consists of 2 alphabet characters and 6 digits or 4 alphabet characters and 8 digits.
LOCUS BR000000 1203 bp DNA linear INV 24-OCT-2023
DEFINITION TPA_inf: Ladona fulva ELOVL9 mRNA for elongation of very
long chain fatty acids protein 9, complete cds
ACCESSION BR000000
VERSION BR000000.1
KEYWORDS Third Party Data; TPA; TPA:inferential.
SOURCE Ladona fulva (scarce chaser)
ORGANISM Ladona fulva
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda;
Insecta; Pterygota; Palaeoptera; Odonata; Epiprocta;
Anisoptera; Libellulidae; Ladona.
REFERENCE 1 (bases 1 to 1203)
AUTHORS Mishima,H. and Shizuoka,T.
TITLE Direct Submission
JOURNAL Submitted (08-SEP-2022)
Contact:Hanako Mishima
National Institute of Genetics, DNA Data Bank of Japan; Yata 1111,
Mishima, Shizuoka 411-8540, Japan
REFERENCE 2
AUTHORS Mishima,H., Shizuoka,T. and Fuji,I.
TITLE Molecular basis of wax-based color change and UV
reflection in dragonflies
JOURNAL Elife 8, e43045 (2019)
COMMENT THIRD PARTY DATABASE: This TPA record uses data from INSD
entry ********.*
PRIMARY TPA_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-211 ZZ000001.1 558648-558708
195-352 ZZ000012.1 465516-465706 c
339-533 ZZ000101.1 465272-465352
526-789 ZZ123456.1 464731-464787 c
754-1022 ZZ234567.1 462998-463103
1005-1198 ZZ234568.1 462269-462405 c
1002-1203 ZZ345679.1 460365-460532 c
FEATURES Location/Qualifiers
source 1..1203
/db_xref="taxon:123851"
/geo_loc_name="missing: thrid party data"
/collection_date="missing: thrid party data"
/mol_type="genomic DNA"
/organism="Ladona fulva"
CDS join(25..259,361..786,821..960)
/codon_start=1
/gene="ELOVL9"
/product="elongation of very long chain fatty
acids protein 9"
/protein_id="xxxxxxxxxx.1"
/transl_table=1
/translation="MAAIASQVVDKYFEFMETKSDPRTSEWFLMSGP
GPLVFVLVTYLYFCNKVGPQWMEKRKPYDLKPLLIAYNLIQVLFSVW
LVWEGLQGGWLHHYNLKCQPVDYSNDPVAIRMANACWWYFFCKLIEL
LDTVFFVLRKKNNQISFLHLYHHTLMPVCAWIGTKFLPGGHGTFLGV
INSFVHIIMYFYYMMSAMGPQYQKYIWWKKYLTTLQMVQFCMIFIHS
SQLLIYECNYPKTIIVLLGINALFFLGLFGNFYRKSYKARNMKVE
"
BASE COUNT 214 a 156 c 174 g 257 t
ORIGIN
1 atggcggcga tcgctagcca ggttgttgac aagtatttcg agttcatgga gaccaagagc
:
-- The rest of sequence is omitted --
//
- Example of TPA-assembly
- Basically, a TPA-Assembly entry submitted to DDBJ is assigned an accession number that consists of 2 alphabet characters and 6 digits or 4 alphabet characters and 8 digits.
LOCUS EZZZ01000001 259680 bp DNA linear VRT 24-OCT-2023
DEFINITION TPA_asm: Casuarius casuarius DNA, secondary_bubble21.
ACCESSION EZZZ01000001 EZZZ01000000
VERSION EZZZ01000001.1
DBLINK BioProject:PRJDB99999
Sequence Read Archive:SRR9999990, SRR9999991,
SRR9999992, SRR9999993
BioSample:SAMD99999999
KEYWORDS WGS; Third Party Data; TPA; TPA:assembly.
SOURCE Casuarius casuarius (southern cassowary)
ORGANISM Casuarius casuarius
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Euteleostomi; Archelosauria; Archosauria; Dinosauria;
Saurischia; Theropoda; Coelurosauria; Aves;
Palaeognathae; Casuariiformes; Casuariidae; Casuarius.
REFERENCE 1 (bases 1 to 259680)
AUTHORS Mishima,H. and Shizuoka,T.
TITLE Direct Submission
JOURNAL Submitted (11-NOV-2022)
Contact:Hanako Mishima
National Institute of Genetics, DNA Data Bank of Japan; Yata 1111,
Mishima, Shizuoka 411-8540, Japan
REFERENCE 2
AUTHORS Mishima,H., Shizuoka,T. and Fuji,I.
TITLE Diploid genome assembly of Analysis of the Casuarius
casuarius.
JOURNAL Genome Biol Evol (2023)
REMARK Publication Status: Available-Online prior to print
DOI:10.xxx/xxxx/xxxxxx
COMMENT
##Genome-Assembly-Data-START##
Assembly Method :: HGAP v. 1.0; Celera Assembler v. 7.0;
Quiver v. 1.4.0; Sequencher v. 5.1
Assembly Name :: MusC56 v1
Genome Coverage :: 238x
Sequencing Technology :: PacBio RS, Illumina GAIIx
##Genome-Assembly-Data-END##
Third party assembly of primary data,
SRR9999990-SRR9999993.
This is a diploid assembly of female cassowary
individual. Thealternate pseudohaplotype (secondary
bubble) contigs are secondary_bubble21 -
secondary_bubble181348. The unassigned (non
bubble hetero) contigs are non_bubble_hetero3148954 -
non_bubble_hetero3150069.The homologous (non bubble
other) contigs are
non_bubble_other181349-non_bubble_other181377.
FEATURES Location/Qualifiers
source 1..259680
/db_xref="taxon:8787"
/geo_loc_name="missing: thrid party data"
/collection_date="missing: thrid party data"
/submitter_seqid="secondary_bubble21"
/mol_type="genomic DNA"
/organism="Casuarius casuarius"
CDS join(36..256,321..597,712..891)
/codon_start=1
/locus_tag="ABCDS_000010"
/product="hypothetical protein"
/protein_id="xxxxxxxxxx.1"
/transl_table=1
/translation="MSKSIRNPIYPPVKGTVFDQLFYNRLYDYQTEM
ANIEHVLKTNFSKYSKGKYNQDIVSDIFGQGIFVVDGEKWKQQRKLA
SFFSTRVLRDFSCSVFRRNAFEISGATKSFDMQDILMRCTLDSIFKV
GFGIDLNCLEGSSKEGTAFMDPEENDTYLRDIILNFMIAGKDTSANT
LSWFLYMLCKNPLIQEKVAQEVRDVVGGQVGDPDELVANITDAALEK
MHYL"
assembly_gap 921..1156
/estimated_length=236
/gap_type="within scaffold"
/linkage_evidence="paired_ends"
BASE COUNT 54123 a 69116 c 62143 g 62168 t
ORIGIN
1 aaaaaaagag gttaaaaaat ctgggagttg cttagctaca ctagactgat ccttgaggaa
:
-- The rest of sequence is omitted --
//